KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_0401Help
Entry
SP_0401           CDS       T00057                                 

Definition
helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:spn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(379812..382178)
Genome map
AA seq 788 aa AA seqDB search
MEVYFSGTIERIIFENPSNFYRILLLEIDDTDAEDFDDFEIIVTGTMADVIEGEDYTFWG
QIVQHSKYGEQLQISRYDRAKPTSKGLVKYFSSSHFKGIGLKTAQKIVDTYGENTIDEIL
QHPEKLEGIAGLSAKNREAFVSTLRLNYGTEMILAKLANYGIPNKLAFQIQDFYKEETLD
VVENYPYQLVEDIKGLGFTIADQLAEELGIESQAPERFRAGLVHSLFQACMETGDTYVEA
RDLLEQTLTLLESSRPVELDPSQVAQELSYLIEEDKVQQIDTKIFDNSLFFAEEGIRSHL
VRILEKGKQKSHDLETIQKHITTVEQELGIEYDNIQKQAICDAIQNKVFILTGGPGTGKT
TVINGIIAVYALLEGLDFRKKSNLPILLAAPTGRAARRMNELTGLPSATIHRHLGMTGDD
DTSHLEDYLDADFIIVDEFSMVDTWLANQLFSNISSNSKILIVGDSDQLPSVSPGQVLAD
LLHIPLIPQTRLEKIYRQSKESTIVTLASQIRQGILPADFTQKKADRSYFEIASGHIPAT
IEKILGAALRNGIPARDIQVLAPMYRGTAGIDAINQLMQDLLNPPQKDQLSFEAPQCHYR
KRDRVIHLVNDAEINVFNGDLGAITDLIPGKYTESKQDEIVIDFDGNEVSYPRNEWYKIR
LAYAMSIHKSQGSEFPVVILPITSASRRMLERNLIYTAITRAKSKLILLGELQAFDYATQ
HIGTARKTYLIERFSDLLENVEEKQQAVSETVTSSASEQSYILTEENWDRIPAMIGITDT
DLKEIFGK
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggaagtttatttttcaggaactattgaacggattatttttgaaaatcccagcaatttt
tatcgcatcctcctcctagaaatcgacgatacggacgcagaggattttgatgattttgaa
atcattgtcacaggaaccatggctgatgtaattgagggcgaagactatactttttggggg
caaattgtccagcactccaagtatggagaacaactgcaaatcagtcgttatgatcgcgca
aaaccaactagtaagggcttggtcaagtacttttcaagtagccatttcaaggggattggt
ctcaagacagctcagaaaatcgtggatacctatggcgaaaataccattgacgaaattttg
caacacccagaaaagttagaaggcatcgcaggactctctgccaaaaatcgcgaggctttc
gtctccactctccgtctcaactacggaacggagatgattttggccaaactagccaactac
ggcattcccaacaaactagcctttcagattcaagacttttacaaggaagaaacccttgat
gtggttgaaaattatccctaccagctggttgaggatatcaagggtttgggctttaccatt
gctgaccaactagctgaggaactaggcatcgaaagtcaggctcctgaacgcttccgcgcc
ggtctagttcacagtctttttcaggcctgtatggaaacaggggacacctatgttgaagca
cgggatttgctggaacaaacccttactctccttgagtcttcccgtcccgtggaactagac
cccagccaagttgcccaagagctctcctacctgatcgaagaagacaaggttcagcagatt
gataccaagatctttgacaacagcctctttttcgctgaggaaggcatccgcagtcacttg
gttcgtatccttgaaaaaggaaaacagaagagtcatgatttagaaaccattcaaaaacat
atcactactgtcgagcaagaactgggaattgagtatgataacattcaaaaacaggctatc
tgtgatgctatccagaataaggtctttatcctgacaggtgggcctggtactggtaagaca
actgttatcaatggaatcattgctgtttatgcccttttagaaggacttgacttcaggaag
aaaagcaatctgcccattcttcttgctgctccaactggtcgagctgctcgtcgcatgaat
gaattgacaggtttgcctagcgcgaccatacatcgccacttgggaatgacaggtgacgat
gataccagtcatctggaagattacctagatgctgactttatcatcgtggatgaattctct
atggtagatacttggctggccaatcaactcttctccaatatctcttctaacagtaagatc
ctcatcgtaggtgacagtgatcagctaccttctgtcagtcctggacaggttctagcggat
ctacttcatattcctttgattcctcagactcgcttggaaaaaatttatcgacaaagcaaa
gaatcaaccatcgtcaccctagctagtcagattcgacagggcatcttgccagctgatttc
acccaaaaaaaagctgaccgttcctactttgaaattgctagtggccatattcctgccacc
attgaaaaaatcttaggtgccgccctcagaaatggtattcccgcccgtgatatccaagtt
ctggctcctatgtaccgagggacggcagggattgatgctatcaatcagctcatgcaagac
ctgctcaatcccccacaaaaagatcaactcagttttgaagctcctcagtgtcactatcgt
aagagagacagggtcattcatttggttaacgatgctgaaatcaatgtctttaatggggat
ttaggagctatcacagacctgattcctggtaaatacaccgaatcgaaacaagacgagatt
gtcattgattttgatggtaatgaagtctcttacccccgtaacgaatggtacaagattcgc
ttggcctatgccatgagtattcataagtctcagggaagtgagttcccagttgtcatccta
ccgattactagtgctagccgacgtatgctggagcgaaatctcatctacacagccattaca
cgtgccaaaagcaaactcatcttactaggcgaattacaagccttcgactatgctacccaa
cacatcggaactgcccgaaaaacctatctgattgaacgcttcagtgatctactggagaat
gttgaagaaaagcaacaagctgtctctgaaacagtcacatcaagtgcctctgaacaatcc
tacatcctaaccgaagaaaactgggaccgcatcccagccatgattgggattacagacaca
gacctcaaagagatttttggaaaatag

DBGET integrated database retrieval system