KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_0648Help
Entry
SP_0648           CDS       T00057                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SP_0648
  Lipid metabolism
   00600 Sphingolipid metabolism
    SP_0648
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SP_0648
Enzymes [BR:spn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SP_0648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
615442..622143
Genome map
AA seq 2233 aa AA seqDB search
MGKGHWNRKRVYSIRKFAVGACSVMIGTCAVLLGGNIAGESVVYADETLITHTAEKPKEE
KMIVEEKADKALETKNIVERTEQSEPSSTEAIASEKKEDEAVTPKEEKVSAKPEEKAPRI
ESQASNQEKPLKEDAKAVTNEEVNQMIEDRKVDFNQNWYFKLNANSKEAIKPDADVSTWK
KLDLPYDWSIFNDFDHESPAQNEGGQLNGGEAWYRKTFKLDEKDLKKNVRLTFDGVYMDS
QVYVNGQLVGHYPNGYNQFSYDITKYLQKDGRENVIAVHAVNKQPSSRWYSGSGIYRDVT
LQVTDKVHVEKNGTTILTPKLEEQQHGKVETHVTSKIVNTDDKDHELVAEYQIVERGGHA
VTGLVRTASRTLKAHESTSLDAILEVERPKLWTVLNDKPALYELITRVYRDGQLVDAKKD
LFGYRYYHWTPNEGFSLNGERIKFHGVSLHHDHGALGAEENYKAEYRRLKQMKEMGVNSI
RTTHNPASEQTLQIAAELGLLVQEEAFDTWYGGKKPYDYGRFFEKDATHPEARKGEKWSD
FDLRTMVERGKNNPAIFMWSIGNEIGEANGDAHSLATVKRLVKVIKDVDKTRYVTMGADK
FRFGNGSGGHEKIADELDAVGFNYSEDNYKALRAKHPKWLIYGSETSSATRTRGSYYRPE
RELKHSNGPERNYEQSDYGNDRVGWGKTATASWTFDRDNAGYAGQFIWTGTDYIGEPTPW
HNQNQTPVKSSYFGIVDTAGIPKHDFYLYQSQWVSVKKKPMVHLLPHWNWENKELASKVA
DSEGKIPVRAYSNASSVELFLNGKSLGLKTFNKKQTSDGRTYQEGANANELYLEWKVAYQ
PGTLEAIARDESGKEIARDKITTAGKPAAVRLIKEDHAIAADGKDLTYIYYEIVDSQGNV
VPTANNLVRFQLHGQGQLVGVDNGEQASRERYKAQADGSWIRKAFNGKGVAIVKSTEQAG
KFTLTAHSDLLKSNQVTVFTGKKEGQEKTVLGTEVPKVQTIIGEAPEMPTTVPFVYSDGS
RAERPVTWSSVDVSKPGIVTVKGMADGREVEARVEVIALKSELPVVKRIAPNTDLNSVDK
SVSYVLIDGSVEEYEVDKWEIAEEDKAKLAIPGSRIQATGYLEGQPIHATLVVEEGNPAA
PAVPTVTVGGEAVTGLTSQKPMQYRTLAYGAKLPEVTASAKNAAVTVLQASAANGMRASI
FIQPKDGGPLQTYAIQFLEEAPKIAHLSLQVEKADSLKEDQTVKLSVRAHYQDGTQAVLP
ADKVTFSTSGEGEVAIRKGMLELHKPGAVTLNAEYEGAKDQVELTIQANTEKKIAQSIRP
VNVVTDLHQEPSLPATVTVEYDKGFPKTHKVTWQAIPKEKLDSYQTFEVLGKVEGIDLEA
RAKVSVEGIVSVEEVSVTTPIAEAPQLPESVRTYDSNGHVSSAKVAWDAIRPEQYAKEGV
FTVNGRLEGTQLTTKLHVRVSAQTEQGANISDQWTGSELPLAFASDSNPSDPVSNVNDKL
ISYNNQPANRWTNWNRTNPEASVGVLFGDSGILSKRSVDNLSVGFHEDHGVGVPKSYVIE
YYVGKTVPTAPKNPSFVGNEDHVFNDSANWKPVTNLKAPAQLKAGEMNHFSFDKVETYAV
RIRMVKADNKRGTSITEVQIFAKQVAAAKQGQTRIQVDGKDLANFNPDLTDYYLESVDGK
VPAVTASVSNNGLATVVPSVREGEPVRVIAKAENGDILGEYRLHFTKDKSLLSHKPVAAV
KQARLLQVGQALELPTKVPVYFTGKDGYETKDLTVEWEEVPAENLTKAGQFTVRGRVLGS
NLVAEITVRVTDKLGETLSDNPNYDENSNQAFASATNDIDKNSHDRVDYLNDGDHSENRR
WTNWSPTPSSNPEVSAGVIFRENGKIVERTVTQGKVQFFADSGTDAPSKLVLERYVGPEF
EVPTYYSNYQAYDADHPFNNPENWEAVPYRADKDIAAGDEINVTFKAIKAKAMRWRMERK
ADKSGVAMIEMTFLAPSELPQESTQSKILVDGKELADFAENRQDYQITYKGQRPKVSVEE
NNQVASTVVDSGEDSFPVLVRLVSESGKQVKEYRIHLTKEKPVSEKTVAAVQEDLPKIEF
VEKDLAYKTVEKKDSTLYLGETRVEQEGKVGKERIFTAINPDGSKEEKLREVVEVPTDRI
VLVGTKPVAQEAKKPQVSEKADTKPIDSSEASQTNKAQLPSTGSAASQAAVAAGLTLLGL
SAGLVVTKGKKED
NT seq 6702 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaggccattggaatcggaaaagagtttatagcattcgtaagtttgctgtggga
gcttgctcagtaatgattgggacttgtgcagttttattaggaggaaatatagctggagaa
tctgtagtttatgcggatgaaacacttattactcatactgctgagaaacctaaagaggaa
aaaatgatagtagaagaaaaggctgataaagctttggaaactaaaaatatagttgaaagg
acagaacaaagtgaacctagttcaactgaggctattgcatctgagaagaaagaagatgaa
gccgtaactccaaaagaggaaaaagtgtctgctaaaccggaagaaaaagctccaaggata
gaatcacaagcttcaaatcaagaaaaaccgctcaaggaagatgctaaagctgtaacaaat
gaagaagtgaatcaaatgattgaagacaggaaagtggattttaatcaaaattggtacttt
aaactcaatgcaaattctaaggaagccattaaacctgatgcagacgtatctacgtggaaa
aaattagatttaccgtatgactggagtatctttaacgatttcgatcatgaatctcctgca
caaaatgaaggtggacagctcaacggtggggaagcttggtatcgcaagactttcaaacta
gatgaaaaagacctcaagaaaaatgttcgccttacttttgatggcgtctacatggattct
caagtttatgtcaatggtcagttagtggggcattatccaaatggttataaccagttctca
tatgatatcaccaaataccttcaaaaagatggtcgtgagaatgtgattgctgtccatgca
gtcaacaaacagccaagtagccgttggtattcaggaagtggtatctatcgtgatgtgact
ttacaagtgacagataaggtgcatgttgagaaaaatgggacaactattttaacaccaaaa
cttgaagaacaacaacatggcaaggttgaaactcatgtgaccagcaaaatcgtcaatacg
gacgacaaagaccatgaacttgtagccgaatatcaaatcgttgaacgaggtggtcatgct
gtaacaggcttagttcgtacagcgagtcgtaccttaaaagcacatgaatcaacaagccta
gatgcgattttagaagttgaaagaccaaaactctggactgttttaaatgacaaacctgcc
ttgtacgaattgattacgcgtgtttaccgtgacggtcaattggttgatgctaagaaggat
ttgtttggttaccgttactatcactggactccaaatgaaggtttctctttgaatggtgaa
cgtattaaattccatggagtatccttgcaccacgaccatggggcgcttggagcagaagaa
aactataaagcagaatatcgccgtctcaaacaaatgaaggagatgggagttaactccatc
cgtacaacccacaaccctgctagtgagcaaaccttgcaaatcgcagcagaactaggttta
ctcgttcaggaagaggcctttgatacgtggtatggtggcaagaaaccttatgactatgga
cgtttctttgaaaaagatgccactcacccagaagctcgaaaaggtgaaaaatggtctgat
tttgacctacgtaccatggtcgaaagaggcaaaaacaaccctgctatcttcatgtggtca
attggtaatgaaataggtgaagctaatggtgatgcccactctttagcaactgttaaacgt
ttggttaaggttatcaaggatgttgataagactcgctatgttaccatgggagcagataaa
ttccgtttcggtaatggtagcggagggcatgagaaaattgctgatgaactcgatgctgtt
ggatttaactattctgaagataattacaaagcccttagagctaagcatccaaaatggttg
atttatggatcagaaacatcttcagctacccgtacacgtggaagttactatcgccctgaa
cgtgaattgaaacatagcaatggacctgagcgtaattatgaacagtcagattatggaaat
gatcgtgtgggttgggggaaaacagcaaccgcttcatggacttttgaccgtgacaacgct
ggctatgctggacagtttatctggacaggtacggactatattggtgaacctacaccatgg
cacaaccaaaatcaaactcctgttaagagctcttactttggtatcgtagatacagccggc
attccaaaacatgacttctatctctaccaaagccaatgggtttctgttaagaagaaaccg
atggtacaccttcttcctcactggaactgggaaaacaaagaattagcatccaaagtagct
gactcagaaggtaagattccagttcgtgcttattcgaatgcttctagtgtagaattgttc
ttgaatggaaaatctcttggtcttaagactttcaataaaaaacaaaccagcgatgggcgg
acttaccaagaaggtgcaaatgctaatgaactttatcttgaatggaaagttgcctatcaa
ccaggtaccttggaagcaattgctcgtgatgaatctggcaaggaaattgctcgagataag
attacgactgctggtaagccagcggcagttcgtcttattaaggaagaccatgcgattgca
gcagatggaaaagacttgacttacatctactatgaaattgttgacagccaggggaatgtg
gttccaactgctaataatctggttcgcttccaattgcatggccaaggtcaactggtcggt
gtagataacggagaacaagccagccgtgaacgctataaggcgcaagcagatggttcttgg
attcgtaaagcatttaatggtaaaggtgttgccattgtcaaatcaactgaacaagcaggg
aaattcaccctgactgcccactctgatctcttgaaatcgaaccaagtcactgtctttact
ggtaagaaagaaggacaagagaagactgttttggggacagaagtgccaaaagtacagacc
attattggagaggcacctgaaatgcctaccactgttccgtttgtatacagtgatggtagc
cgtgcagaacgtcctgtaacctggtcttcagtagatgtgagcaagcctggtattgtaacg
gtgaaaggtatggctgacggacgagaagtagaagctcgtgtagaagtgattgctcttaaa
tcagagctaccagttgtgaaacgtattgctccaaatactgacttgaattctgtagacaaa
tctgtttcctatgttttgattgatggaagtgttgaagagtatgaagtggacaagtgggag
attgccgaagaagataaagctaagttagcaattccaggttctcgtattcaagcgaccggt
tatttagaaggtcaaccaattcatgcaacccttgtggtagaagaaggcaatcctgcggca
cctgcagtaccaactgtaacggttggtggtgaggcagtaacaggtcttactagtcaaaaa
ccaatgcaataccgcactcttgcttatggagctaagttgccagaagtcacagcaagtgct
aaaaatgcagctgttacagttcttcaagcaagcgcagcaaacggcatgcgtgcgagcatc
tttattcagcctaaagatggtggccctcttcaaacctatgcaattcaattccttgaagaa
gcgccaaaaattgctcacttgagcttgcaagtggaaaaagctgacagtctcaaagaagac
caaactgtcaaattgtcggttcgagctcactatcaagatggaacgcaagctgtattacca
gctgataaagtaaccttctctacaagtggtgaaggggaagtcgcaattcgtaaaggaatg
cttgagttgcataagccaggagcagtcactctgaacgctgaatatgagggagctaaagac
caagttgaactcactatccaagccaatactgagaagaagattgcgcaatccatccgtcct
gtaaatgtagtgacagatttgcatcaggaaccaagtcttccagcaacagtaacagttgag
tatgacaaaggtttccctaaaactcataaagtcacttggcaagctattccgaaagaaaaa
ctagactcctatcaaacatttgaagtactaggtaaagttgaaggaattgaccttgaagcg
cgtgcaaaagtctctgtagaaggtatcgtttcagttgaagaagtcagtgtgacaactcca
atcgcagaagcaccacaattaccagaaagtgttcggacatatgattcaaatggtcacgtt
tcatcagctaaggttgcatgggatgcgattcgtccagagcaatacgctaaggaaggtgtc
tttacagttaatggtcgcttagaaggtacgcaattaacaactaaacttcatgttcgcgta
tctgctcaaactgagcaaggtgcaaacatttctgaccaatggaccggttcagaattgcca
cttgcctttgcttcagactcaaatccaagcgacccagtttcaaatgttaatgacaagctc
atttcctacaataaccaaccagccaatcgttggacaaactggaatcgtactaatccagaa
gcttcagtcggtgttctgtttggagattcaggtatcttgagcaaacgctccgttgataat
ctaagtgtcggattccatgaagaccatggagttggtgtaccgaagtcttatgtgattgag
tattatgttggtaagactgtcccaacagctcctaaaaaccctagttttgttggtaatgag
gaccatgtctttaatgattctgccaactggaaaccagttactaatctaaaagcccctgct
caactcaaggctggagaaatgaaccactttagctttgataaagttgaaacctatgctgtt
cgtattcgcatggttaaagcagataacaagcgtggaacgtctatcacagaggtacaaatc
tttgcgaaacaagttgcggcagccaagcaaggacaaacaagaatccaagttgacggcaaa
gacttagcaaacttcaaccctgatttgacagactactaccttgagtctgtagatggaaaa
gttccggcagtcacagcaagtgttagcaacaatggtctcgctaccgtcgttccaagcgtt
cgtgaaggtgagccagttcgtgtcatcgcgaaagctgaaaatggcgacatcttaggagaa
taccgtctgcacttcactaaggataagagcttactttctcataaaccagttgctgcggtt
aaacaagctcgcttgctacaagtaggtcaagcacttgaattgccgactaaggttccagtt
tacttcacaggtaaagacggctacgaaacaaaagacctgacagttgaatgggaagaagtt
ccagcggaaaatctgacaaaagcaggtcaatttactgttcgaggccgtgtccttggtagt
aaccttgttgctgagatcactgtacgagtgacagacaaacttggtgagactctttcagat
aaccctaactatgatgaaaacagtaaccaggcctttgcttcagcaaccaatgatattgac
aaaaactctcatgaccgcgttgactatctcaatgacggagatcattcagaaaatcgtcgt
tggacaaactggtcaccaacaccatcttctaatccagaagtatcagcgggtgtgattttc
cgtgaaaatggtaagattgtagaacggactgttacacaaggaaaagttcagttctttgca
gatagtggtacggatgcaccatctaaactcgttttagaacgctatgtcggtccagagttt
gaagtgccaacctactattcaaactaccaagcctacgacgcagaccatccattcaacaat
ccagaaaattgggaagctgttccttatcgtgcggataaagacattgcagctggtgatgaa
atcaacgtaacatttaaagctatcaaagccaaagctatgagatggcgtatggagcgtaaa
gcagataagagcggtgttgcgatgattgagatgaccttccttgcaccaagtgaattgcct
caagaaagcactcaatcaaagattcttgtagatggaaaagaacttgctgatttcgctgaa
aatcgtcaagactatcaaattacctataaaggtcaacggccaaaagtctcagttgaagaa
aacaatcaagtagcttcaactgtggtagatagtggagaagatagctttccagtacttgtt
cgcctcgtttcagaaagtggaaaacaagtcaaggaataccgtatccacttgactaaggaa
aaaccagtttctgagaagacagttgctgctgtacaagaagatcttccaaaaatcgaattt
gttgaaaaagatttggcatacaagacagttgagaaaaaagattcaacactgtatctaggt
gaaactcgtgtagaacaagaaggaaaagttggaaaagaacgtatctttacagcgattaat
cctgatggaagtaaggaagaaaaactccgtgaagtggtagaagttccgacagaccgcatc
gtcttggttggaaccaaaccagtagctcaagaagctaaaaaaccacaagtgtcagaaaaa
gcagatacaaaaccaattgattcaagtgaagctagtcaaactaataaagcccagttacca
agtacaggtagtgcggcaagccaagcagcagtagcagcaggtttaactcttctaggtttg
agtgcaggattagtagttactaaaggtaaaaaagaagactag

DBGET integrated database retrieval system