KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_0668Help
Entry
SP_0668           CDS       T00057                                 

Gene name
gki
Definition
(GenBank) glucokinase (EC:2.7.1.2)
  KO
K00845  
glucokinase [EC:2.7.1.2]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SP_0668 (gki)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SP_0668 (gki)
   00052 Galactose metabolism
    SP_0668 (gki)
   00500 Starch and sucrose metabolism
    SP_0668 (gki)
   00520 Amino sugar and nucleotide sugar metabolism
    SP_0668 (gki)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SP_0668 (gki)
   00524 Butirosin and neomycin biosynthesis
    SP_0668 (gki)
Enzymes [BR:spn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SP_0668 (gki)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
644073..645035
Genome map
AA seq 320 aa AA seqDB search
MMSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDEGSHIVDDMIESIQHRLDLLG
LAAADFQGIGMGSPGVVDRDKGTVIGAYNLNWKTLQPIKQKIEKALGIPFFIDNDANVAA
LGERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGELGHITVDFDQPISCTC
GKKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDNGEEVTAKTVFDLAKEGDDLALI
VYRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLQGVQKVYDENSFPQVRTSTKL
ALATLGNDAGVIGAASLVLQ
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtcaaaagattattgggattgaccttggtggaacttctatcaaatttgcaatc
ttaacaacagcaggagaaatccaaggaaaatggtcaatcaagaccaacattttggatgag
ggaagtcatatcgttgatgatatgattgagtctattcaacatcgtttggacttgcttgga
ttggcagcagcggacttccaaggcattggaatgggatcaccaggtgtggttgaccgtgac
aaagggactgttatcggtgcctacaacttgaactggaaaacccttcaaccaatcaaacaa
aagattgaaaaagctttgggcattccatttttcatcgataatgatgccaacgtagcagct
cttggtgagcgctggatgggtgctggagataaccaaccagacgttgtctttatgacactc
ggtactggtgttggtggtggtattgtcgcagaaggcaaattgcttcatggtgttgctggt
gcagcaggtgaacttggtcatatcactgttgactttgaccaaccaatctcatgtacttgt
ggtaaaaaaggctgccttgagacagttgcttcagcaacagggattgtcaacttgactcgt
cgctatgccgatgaatacgaaggcgatgcagccttgaaacgcttgattgataacggagaa
gaagtaactgctaagactgtctttgatctcgcaaaagaaggagacgaccttgctttgatt
gtttaccgtaacttctcacgttacttgggaatcgcttgtgctaacattggttcaatccta
aacccatcaacaatcgtcatcggtggtggtgtgtcagctgcgggagaattccttctacaa
ggtgttcaaaaagtttacgatgaaaatagtttcccacaagtacgcacatctactaaatta
gctcttgcaactctaggaaatgacgctggagttatcggagcagcatcacttgtattgcaa
taa

DBGET integrated database retrieval system