KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_0668Help
Entry
SP_0668           CDS       T00057                                 

Gene name
gki
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
spn00010  Glycolysis / Gluconeogenesis
spn00052  Galactose metabolism
spn00500  Starch and sucrose metabolism
spn00520  Amino sugar and nucleotide sugar metabolism
spn00521  Streptomycin biosynthesis
spn01100  Metabolic pathways
spn01110  Biosynthesis of secondary metabolites
spn01120  Microbial metabolism in diverse environments
spn01130  Biosynthesis of antibiotics
spn01200  Carbon metabolism
Module
spn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SP_0668 (gki)
   00052 Galactose metabolism
    SP_0668 (gki)
   00500 Starch and sucrose metabolism
    SP_0668 (gki)
   00520 Amino sugar and nucleotide sugar metabolism
    SP_0668 (gki)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SP_0668 (gki)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SP_0668 (gki)
Enzymes [BR:spn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SP_0668 (gki)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: AAK74813
UniProt: A0A0H2UP34
Position
644073..645035
Genome map
AA seq 320 aa AA seqDB search
MMSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDEGSHIVDDMIESIQHRLDLLG
LAAADFQGIGMGSPGVVDRDKGTVIGAYNLNWKTLQPIKQKIEKALGIPFFIDNDANVAA
LGERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGELGHITVDFDQPISCTC
GKKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDNGEEVTAKTVFDLAKEGDDLALI
VYRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLQGVQKVYDENSFPQVRTSTKL
ALATLGNDAGVIGAASLVLQ
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtcaaaagattattgggattgaccttggtggaacttctatcaaatttgcaatc
ttaacaacagcaggagaaatccaaggaaaatggtcaatcaagaccaacattttggatgag
ggaagtcatatcgttgatgatatgattgagtctattcaacatcgtttggacttgcttgga
ttggcagcagcggacttccaaggcattggaatgggatcaccaggtgtggttgaccgtgac
aaagggactgttatcggtgcctacaacttgaactggaaaacccttcaaccaatcaaacaa
aagattgaaaaagctttgggcattccatttttcatcgataatgatgccaacgtagcagct
cttggtgagcgctggatgggtgctggagataaccaaccagacgttgtctttatgacactc
ggtactggtgttggtggtggtattgtcgcagaaggcaaattgcttcatggtgttgctggt
gcagcaggtgaacttggtcatatcactgttgactttgaccaaccaatctcatgtacttgt
ggtaaaaaaggctgccttgagacagttgcttcagcaacagggattgtcaacttgactcgt
cgctatgccgatgaatacgaaggcgatgcagccttgaaacgcttgattgataacggagaa
gaagtaactgctaagactgtctttgatctcgcaaaagaaggagacgaccttgctttgatt
gtttaccgtaacttctcacgttacttgggaatcgcttgtgctaacattggttcaatccta
aacccatcaacaatcgtcatcggtggtggtgtgtcagctgcgggagaattccttctacaa
ggtgttcaaaaagtttacgatgaaaatagtttcccacaagtacgcacatctactaaatta
gctcttgcaactctaggaaatgacgctggagttatcggagcagcatcacttgtattgcaa
taa

DBGET integrated database retrieval system