KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_0931Help
Entry
SP_0931           CDS       T00057                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:spn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SP_0931
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SP_0931
Enzymes [BR:spn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SP_0931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
884172..885281
Genome map
AA seq 369 aa AA seqDB search
MKYKRIVFKVGTSSLTNEDGSLSRSKVKDITQQLAMLHEAGHELILVSSGAIAAGFGALG
FKKRPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQILLTQDDFVDKRRYKNAHQAL
SVLLNRGAIPIINENDSVVIDELKVGDNDTLSAQVAAMVQADLLVFLTDVDGLYTGNPNS
DPRAKRLERIETINREIIDMAGGAGSSNGTGGMLTKIKAATIATESGVPVYICSSLKSDS
MIEAAEETEDGSYFVAQEKGLRTQKQWLAFYAQSQGSIWVDKGAAEALSQYGKSLLLSGI
VEAEGVFSYGDIVTVFDKESGKSLGKGRVQFGASALEDMLRSQKAKGVLIYRDDWISITP
EIQLLFTEF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaacggattgtctttaaggtgggtacttcttctctgacaaatgaggatgga
agtttatcacgtagtaaggtaaaggatattacccagcagttggctatgctgcacgaggct
ggtcatgagttgattttggtgtcttcaggtgccattgcggctggttttggagccttagga
tttaaaaagcgtccgactaagattgctgataaacaggcttcagcagcggtagggcagggg
cttttgttggaagaatatacaaccaatcttctcttgcgtcaaatcgtttctgcacaaatc
ttgctgacccaagatgactttgtggataagcgtcgttataaaaatgcccatcaggctttg
tcggttttgctcaaccgtggggcaattcctatcatcaatgagaatgatagtgtcgttatt
gatgagctcaaggttggggacaatgacactctaagtgctcaagtagcggcgatggtccaa
gcagaccttttagttttcttgacagatgtggacggtctctatactggaaatcctaattca
gatccaagagccaaacgcttggagagaatcgagaccatcaatcgtgagattattgatatg
gctggtggagctggttcgtcaaacggaactgggggtatgttaaccaaaatcaaggctgca
actatcgcgacggaatcaggagttcctgtttatatctgctcatccttgaaatcagattcc
atgattgaggcggcagaggagaccgaggatggttcttactttgttgctcaagagaagggg
cttcgtacccagaaacaatggcttgccttctatgctcagagtcaaggttctatttgggtt
gataaaggggctgcggaagctctctctcaatatggaaagagtcttctcttatctggtatc
gttgaagcagaaggagtcttttcttacggtgatatcgtgacagtatttgacaaggaaagt
ggaaaatcacttggaaaaggacgcgtgcaatttggagcatctgctttggaggatatgttg
cgttctcaaaaagccaagggtgtcttgatttaccgtgacgactggatttccattactcct
gaaatccaactactttttacagaattttag

  All links  
No link information was found.   
DBGET integrated database retrieval system