KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1672Help
Entry
SP_1672           CDS       T00057                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:spn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SP_1672 (recR)
DNA repair and recombination proteins [BR:spn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SP_1672 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1572389..1572985)
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSYSKLPGIGIKTATRLAFYTIGMSADDVNEFAKNLLSAKRELTYCSIC
GRLTDDDPCSICTDPTRDQTTILVLEDSRDVAAMENIQEYHGLYHVLHGLISPMNGISPD
DINLKSLMTRLMDSEVSEVIVATNATADGEATSMYLSRLLKPAGIKVTRLARGLAVGADI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctttatccaacacctattgccaagttgattgacagttattctaagttaccaggtatc
gggattaagacggctacgcgtctggccttttatacgattgggatgtctgctgatgatgtc
aatgaatttgcaaaaaatctcctttctgctaagagagaattgacatattgttctatttgt
ggacgtttgacagacgacgatccttgttctatctgtactgatccgactcgtgaccagaca
acaattttagttcttgaggatagtagagatgtggcagccatggaaaatatccaagaatac
catggactctatcatgtccttcatggcctcatttctcctatgaatggtatcagtccggac
gatatcaatctcaagagccttatgactcgtcttatggatagtgaggtttcagaagtgatt
gtggcgactaatgctacagcggatggtgaagcgacttccatgtatctttcacgtttgctc
aagccggctggtatcaaggttacgcgtctagcacgaggtctcgctgtgggagcggacatt
gagtatgcggacgaagtgacactcttacgagccattgaaaatcggacagagttgtaa

DBGET integrated database retrieval system