KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1812Help
Entry
SP_1812           CDS       T00057                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SP_1812
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SP_1812
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SP_1812
Enzymes [BR:spn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SP_1812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1725201..1726424)
Genome map
AA seq 407 aa AA seqDB search
MAYQEPNKDGFYGKFGGRFVPETLMTAVLELEKAYRESQADPSFQEELNQLLRQYVGRET
PLYYAKNLTQHIGGAKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGAGQHG
VATATAAALFNMECTIYMGEEDVKRQALNVFRMELLGAKVEAVTDGSRVLKDAVNAALRS
WVANIDDTHYILGSALGPHPFPEIVRDFQSVIGREAKQQYRDLTGRDLPDALVACVGGGS
NAIGLFHPFVEDESVAMYGTEAAGLGVDTEHHAATLTKGRPGVLHGSLMDVLQDAHGQIL
EAFSISAGLDYPGIGPEHSHYHDIKRASYVPVTDEEALEGFQLLSRVEGIIPALESSHAI
AFAVKLAKELGPEKSMIVCLSGRGDKDVVQVKDRLEADAAKKGEAHA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcaggaaccaaataaagatggattttacggaaaattcggcggacgttttgtc
ccagaaacattgatgacagcagttttggagttggagaaggcctaccgtgaaagtcaggca
gacccaagtttccaagaggaattaaaccagcttttgcgccagtacgtaggacgtgaaact
cctctttattacgcaaaaaacttgacccagcatattggcggagccaagatttatctcaaa
cgggaagaccttaaccatacaggagcccacaagattaacaatgccttaggacaagtttgg
cttgccaaacgcatgggtaaaaagaaaattatcgcagaaacgggtgctggtcagcacggt
gtggcaactgcaactgctgcagccctctttaacatggaatgtaccatctacatgggtgag
gaagatgtcaaacgccaagccctcaatgtcttccgcatggagcttttgggagccaaggtc
gaggctgtaacagatggttcgcgcgtgctcaaggatgcggtcaatgcagcccttcgttca
tgggtggctaatatcgacgatacccactatatccttggttctgccttggggcctcatcca
tttccagaaatcgttcgtgacttccaaagtgtcatcggtcgagaggctaaacaacagtac
cgtgacttgacaggtcgagatctgccagatgccctagtagcctgtgttggtggtgggtcg
aatgctatcgggctcttccatccctttgtagaagatgagtcagtagctatgtatggaact
gaagcagcagggcttggtgtggatacagagcaccacgcagctaccttgaccaagggtcgt
ccaggtgtccttcacggttccctcatggatgtgctccaagatgcccatggtcaaattctt
gaagccttctctatctcagcaggtttggactatcctggtatcggtccagagcattctcac
taccacgatattaaacgtgccagctatgtccctgtgacagacgaagaagccttggaagga
ttccaactcttgtctcgtgtggaagggattatcccagccttggaatctagccatgctatc
gcctttgcggtgaaattggccaaagaacttggaccagaaaagtctatgattgtctgccta
tcaggtcgtggggacaaggatgtggttcaagtcaaggaccgcttggaagcagatgcagca
aagaagggagaagctcatgcctaa

DBGET integrated database retrieval system