KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1814Help
Entry
SP_1814           CDS       T00057                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
spn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spn01100  Metabolic pathways
spn01110  Biosynthesis of secondary metabolites
spn01130  Biosynthesis of antibiotics
spn01230  Biosynthesis of amino acids
Module
spn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SP_1814 (trpC)
Enzymes [BR:spn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SP_1814 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NeuB DUF5390 Rho_N
Motif
Other DBs
NCBI-ProteinID: AAK75887
UniProt: Q97P30
Position
complement(1726988..1727755)
Genome map
AA seq 255 aa AA seqDB search
MSQEFLARILEQKAREVEQMKLEQIQPLRQTYRLAEFLKNHQDRLQVIAEVKKASPSLGD
INLDVDIVQQAQTYEENGAVMISVLTDEVFFKGHLDYLREISSQVEIPTLNKDFIIDEKQ
IIRARNAGATVILLIVAALSEERLKELYDYATELGLEVLVETHNLAELEVAHRLGAEIIG
VNNRNLTTFEVDLQTSVDLAPYFEEGRYYISESAIFTGQDAERLAPYFNGILVGTALMQA
ENVAQRIKELQIDKG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggaatttttagcacgaatcttagagcagaaggcgcgtgaggtggagcagatg
aagctggagcaaatccagcctctgcgccagacctatcgcttggcagaatttttgaagaat
catcaggaccgcttgcaggtaatcgctgaggtcaagaaagctagccctagtttgggagat
atcaatctcgatgtggatattgtgcaacaggcccagacttatgaagaaaacggagcagtg
atgatttcggtgttgacagatgaggttttctttaaagggcatttggattatctacgggaa
atttccagtcaggtagagattccgacgctcaacaaagactttatcatcgatgaaaagcaa
atcatccgcgctcgcaatgcaggtgcgacagttatcttgctcattgtggcagccttgtcc
gaagaacgcctcaaggaactgtatgactacgcgacagagcttggtctggaagtcttagtg
gagactcacaatctagctgaactagaggtagcccacagacttggtgctgagattatcggg
gtcaacaaccgcaacttgactacctttgaggtcgacttgcagaccagtgtagatttagcc
ccttactttgaggaaggtcgctattacatttctgaatctgccattttcacagggcaggat
gcggaacgactagccccatactttaacggaattttggtagggacagctcttatgcaggca
gaaaatgtggcccagagaatcaaggagttgcagattgacaaaggttaa

DBGET integrated database retrieval system