KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1814Help
Entry
SP_1814           CDS       T00057                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase (EC:4.1.1.48)
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SP_1814 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SP_1814 (trpC)
Enzymes [BR:spn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SP_1814 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1726988..1727755)
Genome map
AA seq 255 aa AA seqDB search
MSQEFLARILEQKAREVEQMKLEQIQPLRQTYRLAEFLKNHQDRLQVIAEVKKASPSLGD
INLDVDIVQQAQTYEENGAVMISVLTDEVFFKGHLDYLREISSQVEIPTLNKDFIIDEKQ
IIRARNAGATVILLIVAALSEERLKELYDYATELGLEVLVETHNLAELEVAHRLGAEIIG
VNNRNLTTFEVDLQTSVDLAPYFEEGRYYISESAIFTGQDAERLAPYFNGILVGTALMQA
ENVAQRIKELQIDKG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggaatttttagcacgaatcttagagcagaaggcgcgtgaggtggagcagatg
aagctggagcaaatccagcctctgcgccagacctatcgcttggcagaatttttgaagaat
catcaggaccgcttgcaggtaatcgctgaggtcaagaaagctagccctagtttgggagat
atcaatctcgatgtggatattgtgcaacaggcccagacttatgaagaaaacggagcagtg
atgatttcggtgttgacagatgaggttttctttaaagggcatttggattatctacgggaa
atttccagtcaggtagagattccgacgctcaacaaagactttatcatcgatgaaaagcaa
atcatccgcgctcgcaatgcaggtgcgacagttatcttgctcattgtggcagccttgtcc
gaagaacgcctcaaggaactgtatgactacgcgacagagcttggtctggaagtcttagtg
gagactcacaatctagctgaactagaggtagcccacagacttggtgctgagattatcggg
gtcaacaaccgcaacttgactacctttgaggtcgacttgcagaccagtgtagatttagcc
ccttactttgaggaaggtcgctattacatttctgaatctgccattttcacagggcaggat
gcggaacgactagccccatactttaacggaattttggtagggacagctcttatgcaggca
gaaaatgtggcccagagaatcaaggagttgcagattgacaaaggttaa

DBGET integrated database retrieval system