KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1855Help
Entry
SP_1855           CDS       T00057                                 

Definition
(RefSeq) zinc-containing alcohol dehydrogenase
  KO
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SP_1855
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SP_1855
  Lipid metabolism
   00071 Fatty acid degradation
    SP_1855
  Amino acid metabolism
   00350 Tyrosine metabolism
    SP_1855
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SP_1855
   00626 Naphthalene degradation
    SP_1855
Enzymes [BR:spn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SP_1855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1762944..1763981)
Genome map
AA seq 345 aa AA seqDB search
MKSAVYTKAGQVGLASIERPQIIEADDVIIRVVRACVCGSDLWRYRNPETKAGHKNSGHE
AIGIVEEAGEAITTVKPGDFVIVPFTHGCGECDACLAGFDGSCDNHIGNNLGGDFQAEYI
RFHYANWALVKIPGQPSDYTEGMLKSLLTLADVMPTGYHAARVANVQKGDKVVVIGDGAV
GQCAVIAAKMRGASQIILMSRHEDRQKMAMESGATAVVAERGQEGITKVREILGGGADAA
LECVGTEAAIEQALGVLHNGGRMGFVGVPHYNNRALGSTFMQNISVAGGAASATTYDKQF
LLKAVLDGDINPGRVFTSSYKLEDIDQAYKDMDERKTIKSMIVIE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagcagtatatacaaaggcaggtcaggttggacttgctagcattgaacgtccg
caaataatagaagcggatgatgtgattattcgtgtggttcgtgcgtgcgtttgtggttca
gatttatggaggtaccgtaatccagaaacgaaagctggacacaaaaatagtggacacgaa
gcgattgggattgttgaagaagctggggaagccattacgacggtgaaaccaggtgatttt
gtgattgtcccttttacacatggatgtggtgagtgtgatgcctgtcttgctggatttgac
ggttcttgcgacaatcatattggcaataatttggggggtgattttcaggcagaatatatt
cgcttccactatgcaaactgggcgctggttaaaatccctggtcaaccttctgactataca
gaagggatgctcaagtcccttttgactcttgcagatgtcatgccgacaggctatcatgcg
gcgcgtgttgcaaatgttcaaaaaggggacaaggttgttgttatcggtgatggggctgtt
ggtcaatgtgctgtcatcgcggctaagatgcgtggagcatcacaaattatccttatgagc
cgtcatgaagaccgtcaaaagatggctatggagtcaggtgcgacagctgttgttgcagaa
cgtggtcaagaaggaattaccaaggtgcgtgaaatcctcggtggaggagcagatgcagca
cttgaatgtgttggtacggaggctgctatagaacaggcgctaggtgttcttcataatgga
gggcgtatgggctttgtaggagtcccacactataataatcgtgctcttggttcgacattt
atgcaaaatatctctgtagcaggtggggcagcttctgctacaacatacgataagcaattt
ttactaaaagccgtccttgatggtgatatcaatccaggtcgcgtctttacttcaagttat
aaactggaagatatcgaccaagcctataaagatatggatgaacgtaagacaattaagtct
atgattgtaatcgaataa

DBGET integrated database retrieval system