KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1898Help
Entry
SP_1898           CDS       T00057                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:spn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SP_1898
  Lipid metabolism
   00561 Glycerolipid metabolism
    SP_1898
   00600 Sphingolipid metabolism
    SP_1898
Enzymes [BR:spn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SP_1898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1804475..1806637)
Genome map
AA seq 720 aa AA seqDB search
MGVRIENNLFYVESKNLSLIIENRNGYLLLKHLGKTIKNYKGSNSVYERDHAFSGNPTAT
NRTFSLDTQRQIFGQHGLGDFRKPTIQVQHSVTEVTDFRFVEAKILKGQNGPQGLPSPHS
MDDTETLVLMLEDSKAQLSLTLYYTTFNNDATIASYSKLDNNSNQEVVIHKDFSFMADFP
AADYEIVTLQGAYAREKTVRRQQVEQGIFSISSNRGASGHAQTPALLLCEQGVTEDAGNV
FAIQLMYSGNFEAFVQKNQLNEVRVAIGINPENFSWKLAPEEYFETPVALVTHSDQGLTG
ISHESQNFVLKHIMLSEFSKKERPILINNWEATYFDFQREKLLELADEAKKVGIELFVLD
DGWFGNRFDDNRALGDWVVNEEKLGGSLESLISAIHERGLQFGLWLEPEMISVDSDLYRQ
HPDWAIQVPGYEHTYSRNQLVLNLANPQVVEYLKSVLDQLLFYHDIDYIKWDMNRNITKL
GNGLTYLETQMQSHQYMLGLYELVSYLTEKHSHILFESCSGGGGRNDLGMMRYFPQVWAS
DNTDAIARLPIQYGSSYLYPTISMGAHVSAVPNHQMGRMTPLETRGLVAMMGNLGYELDL
TNLSDEEKATIANQVNLYKELRPVVQLGQQYRLINPDTVSNEAAVQFNYGNQTIVTYVRV
LSVVETMETTLKLKDLDEEGLYKLQENGEVYSGAELMYAGLTVILSQGDFLSRQYIFRKL
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgggagttaggatagagaataatctattttatgttgagagtaaaaatctaagtttgatt
attgaaaatcgaaatggctacttacttttgaaacatttaggaaagactattaagaactat
aaaggttccaatagtgtttatgaacgagaccatgccttttcaggaaatccaacggctact
aatcgaacctttagtttagatactcagcgacagatttttggacaacatggcttaggagat
tttaggaaaccaaccatacaggttcagcatagtgtaactgaagtaacagactttcgattt
gtagaagcaaagattttaaaaggtcagaatggtccacagggcttaccttctccacatagc
atggacgatacagagactcttgtcttaatgttagaagattctaaggctcaacttagtctg
actttgtattatactacttttaataatgatgcgactattgctagctacagtaaattagat
aataatagtaatcaggaagttgtcatccataaagatttttcttttatggctgattttcca
gctgcagattacgaaatagtaactctgcagggtgcttatgctcgtgaaaagactgttaga
cgtcaacaggtagaacaaggaatcttttcgattagttcaaaccgaggtgcttctggtcat
gctcaaacaccagctcttctactatgcgaacaaggagtcacagaggatgctgggaatgtg
tttgctattcaactaatgtatagtggcaactttgaagcttttgttcaaaaaaatcaattg
aatgaagttcgggtggctattggcattaatccagaaaacttttcttggaagttagctcct
gaggaatactttgaaacaccggtagctttagtgactcattcagatcagggattaactggt
attagtcatgaaagtcagaattttgtactgaagcacattatgctaagtgaattttctaaa
aaagaacgtccaattctaatcaataactgggaagctacttactttgactttcagagagaa
aaactgttagagttagcagatgaagctaagaaagttggcattgaactttttgtattagat
gatggttggtttggcaatcgttttgatgataatcgtgctttaggtgattgggttgttaat
gaggaaaaactgggtggaagtctagaaagtctgatttcagctatccatgaaagaggtttg
cagtttggactttggttagaacccgaaatgatttctgtagatagtgatttgtatcgtcaa
catcctgactgggctattcaggttcctggctatgagcatacttattctcggaatcaatta
gtacttaatcttgccaatcctcaggtagtagaatacttgaaaagtgtcttagatcaactc
ctattttatcatgatattgattacattaaatgggatatgaaccgcaatatcactaagcta
gggaatggattaacttatctagagacacagatgcaatctcatcagtacatgctggggctt
tatgaactcgtttcttatctgacagagaagcacagccatattctctttgagtcctgctct
ggtggtggtggacgaaatgatcttggtatgatgcgctatttcccacaagtctgggctagt
gataatactgatgccattgcacgtttaccaattcaatacggttcatcctatctctatcca
accatttctatgggggctcatgtgtcagcagtaccgaatcatcagatgggacgaatgaca
ccattagaaacacgtggccttgtagcaatgatgggaaatttgggctatgaacttgatttg
acaaatttatcagatgaagagaaagctacgattgctaatcaggtgaacttgtataaagaa
ttacgaccagtagttcagttaggacagcagtatagactaattaatcctgatactgtatcc
aatgaagcagctgtacaatttaattacggaaatcaaacgattgtaacctacgttcgcgtt
ttatctgttgtagagaccatggaaacaactttaaaattaaaagatttggatgaagaggga
ctatataaattacaggaaaatggcgaagtttactcaggtgcagaactaatgtatgcgggc
ttaactgttatcttatcccaaggagattttttgagtagacagtatatttttagaaaacta
tga

DBGET integrated database retrieval system