KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1966Help
Entry
SP_1966           CDS       T00057                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:spn00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:spn00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1873254..1874537)
Genome map
AA seq 427 aa AA seqDB search
MDKIVVQGGDNRLVGSVTIEGAKNAVLPLLAATILASEGKTVLQNVPILSDVFIMNQVVG
GLNAKVDFDEEAHLVKVDATGDITEEAPYKYVSKMRASIVVLGPILARVGHAKVSMPGGC
TIGSRPIDLHLKGLEAMGVKISQTAGYIEAKAERLHGAHIYMDFPSVGATQNLMMAATLA
DGVTVIENAAREPEIVDLAILLNEMGAKVKGAGTETITITGVEKLHGTTHNVVQDRIEAG
TFMVAAAMTGGDVLIRDAVWEHNRPLIAKLLEMGVEVIEEDEGIRVRSQLENLKAVHVKT
LPHPGFPTDMQAQFTALMTVAKGESTMVETVFENRFQHLEEMRRMGLHSEIIRDTARIVG
GQPLQGAEVLSTDLRASAALILTGLVAQGETVVGKLVHLDRGYYGFHEKLAQLGAKIQRI
EASDEDE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggataaaattgtggttcaaggtggcgataatcgtctggtaggaagcgtgacgatcgag
ggagcaaaaaatgcagtcttacccttgttggcagcgactattctagcaagtgaaggaaag
accgtcttgcagaatgttccgattttgtcggatgtctttattatgaatcaggtagttggt
ggtttgaatgccaaggttgactttgatgaggaagctcatcttgtcaaggtggatgctact
ggcgacatcactgaggaagccccttacaagtatgtcagcaagatgcgcgcctccatcgtt
gtattagggccaatccttgcccgtgtgggtcatgccaaggtatccatgccaggtggttgt
acgattggtagccgtcctattgatcttcatttgaaaggtctggaagctatgggggttaag
attagtcagacagctggttacatcgaagccaaggcagaacgcttgcatggtgctcatatc
tatatggactttccaagtgttggtgcaacgcagaacttgatgatggcagcgactctggct
gatggggtgacagtgattgagaatgctgcgcgtgagcctgagattgttgacttagccatt
ctccttaatgaaatgggagccaaggtcaaaggtgctggtacagagactataaccattact
ggtgttgagaaacttcatggtacgactcacaatgtagtccaagaccgtatcgaagcagga
acctttatggtagctgctgccatgactggtggtgatgtcttgattcgagacgctgtctgg
gagcacaaccgtcccttgattgccaagttacttgaaatgggtgttgaagtaattgaagaa
gacgaaggaattcgtgttcgttctcaactagaaaatctaaaagctgttcatgtgaaaacc
ttgccccacccaggatttccaacagatatgcaggctcaatttacagccttgatgacagtt
gcaaaaggcgaatcaaccatggtggagacagttttcgaaaatcgtttccaacacctagaa
gagatgcgccgcatgggcttgcattctgagattatccgtgatacagctcgtattgttggt
ggacagcctttgcagggagcagaagttctttcaactgaccttcgtgccagtgcggccttg
attttgacaggtttggtagcacagggagaaactgtggtcggtaaattggttcacttggat
agaggttactacggtttccatgagaagttggcgcagctaggtgctaagattcagcggatt
gaggcaagtgatgaagatgaataa

DBGET integrated database retrieval system