KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_2107Help
Entry
SP_2107           CDS       T00057                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SP_2107
Enzymes [BR:spn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SP_2107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2018683..2020200)
Genome map
AA seq 505 aa AA seqDB search
MKKRQSGVLMHISSLPGAYGIGSFGQSAYDFVDFLVRTKQRYWQILPLGATSYGDSPYQS
FSAFAGNTHFIDLDILVEQGLLEASDLEGVDFGSDASEVDYAKIYYARRPLLEKAVKRFF
EVGDVKDFEKFAQDNQSWLELFAEYMAIKEYFDNLAWTEWPDADARARKASALESYREQL
ADKLVYHRVTQYFFFQQWLKLKAYANDNHIEIVGDMPIYVAEDSSDMWANPHLFKTDVNG
KATCIAGCPPDEFSVTGQLWGNPIYDWEAMDKDGYKWWIERLRESFKIYDIVRIDHFRGF
ESYWEIPAGSDTAAPGEWVKGPGYKLFAAVKEELGELNIIAEDLGFMTDEVIELRERTGF
PGMKILQFAFNPEDESIDSPHLAPANSVMYTGTHDNNTVLGWYRNEIDDATREYMARYTN
RKEYETVVHAMLRTVFSSVSFMAIATMQDLLELDEAARMNFPSTLGGNWSWRMTEDQLTP
AVEEGLLDLTTIYRRINENLVDLKK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtcaaagtggtgtgttgatgcacatctcttctcttccaggagcttacgga
atcggatcatttggtcaaagtgcttacgacttcgttgatttcttggtccgtacaaaacaa
cgttactggcaaatccttccattaggagcaactagttacggggattctccttaccaatct
ttctcagccttcgcaggaaacactcattttatcgatttagatatcttggtggagcaaggt
ttgttggaagcaagtgaccttgaaggagttgactttggtagcgatgcgtctgaagttgac
tatgctaaaatctactatgcacgtcgtcctcttttagaaaaagcggtgaaacgtttcttt
gaagtcggagatgttaaagattttgagaaatttgctcaagacaaccaatcatggcttgag
ctctttgctgagtatatggctatcaaagagtattttgacaatcttgcttggactgaatgg
ccagatgcagatgctcgtgctcgtaaagcttcagcacttgaaagctatcgtgagcaattg
gcagacaagttggtttaccaccgtgtgactcaatacttcttcttccaacaatggttgaaa
ttgaaagcttacgctaacgacaaccacatcgaaatcgttggggacatgccaatctacgta
gcggaagattcaagtgatatgtgggcaaatccacatctcttcaaaacagatgtcaatggt
aaggctacttgtatcgcaggatgcccaccagatgagttttctgtaactggtcagctttgg
ggtaatccaatctatgactgggaagcaatggacaaagacggctacaaatggtggattgaa
cgcttgcgtgaaagcttcaaaatctacgatatcgttcgtatcgaccacttccgtggcttc
gaatcttactgggaaatccctgctggttccgatacagcagcacctggtgagtgggtgaaa
ggtccaggttacaagctttttgcagccgttaaggaagaacttggtgagctaaacatcatc
gcagaagaccttggcttcatgacagatgaagtgatcgaattgcgtgaacgtactggcttc
ccaggaatgaagattcttcaatttgccttcaacccagaagacgaaagcattgatagccca
cacttggcacctgctaactcagttatgtacacaggaacacacgataacaatacggttctt
ggttggtaccgtaatgagattgatgatgcgactcgtgagtacatggctcgttacacgaac
cgtaaagaatacgaaacagtggtacacgctatgcttcgtacagtattttcatcagttagc
tttatggcaattgcaactatgcaagatttactagaattggatgaggcagctcgtatgaac
ttcccatctacccttggtggaaactggtcttggcgtatgactgaagatcaattgacacca
gctgtcgaggaaggtttgcttgacttgacaacaatttatcgccgaattaatgaaaatttg
gtagatttaaagaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system