KEGG   Streptococcus pneumoniae SPN034156: SPN034156_00050Help
Entry
SPN034156_00050   CDS       T02628                                 

Gene name
tdk
Definition
putative thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
spne  Streptococcus pneumoniae SPN034156
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spne00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPN034156_00050 (tdk)
Enzymes [BR:spne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SPN034156_00050 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3963..4553
Genome map
AA seq 196 aa AA seqDB search
MAQLYYRYGTMNSGKTIEILKVAYNYEEQGKGVVIMTSALDTRDGVGYVSSRIGMKRPAL
AIEETTDIFGYIRDLPEKPCCVLVDEAQFLKRHHVYDLARVVDELDIPVMAFGLKNDFRN
ELFEGSKYLLLLADKIDEIKTICQYCKKKATMVLRTQDGLPVYDGEQIQIGGNETYISVC
RKHYFAPEINKENEEK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcacagttgtactatcgttatgggaccatgaactctggtaaaacgattgagattctc
aaagtggcctataactacgaggagcaaggaaaaggtgttgtcattatgacctcggctctg
gatacgcgtgacggtgttggctatgtgtcgagtcgaattggcatgaaacgccctgccctt
gcgattgaggaaacaacggatatctttggctatatccgagacctaccagaaaaaccttgc
tgtgttttggtcgatgaagcccagtttcttaaacgccaccatgtttacgacctagctcgt
gttgtggacgagttagacatacccgtcatggcttttggcttgaaaaatgactttcgcaat
gaattgttcgaaggttccaaatatctcttgcttttagcggacaagattgacgaaatcaag
accatctgtcagtattgcaagaaaaaggcgaccatggtgttgcgaacacaggatggactg
cccgtttacgatggagaacagatccagattggtggtaatgaaacctatatctcggtttgc
cgtaaacattattttgcccctgaaatcaataaggagaatgaagaaaaatga

DBGET integrated database retrieval system