KEGG   Streptococcus pneumoniae SPN034156: SPN034156_18820Help
Entry
SPN034156_18820   CDS       T02628                                 

Gene name
proB
Definition
putative glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
spne  Streptococcus pneumoniae SPN034156
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:spne01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:spne00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1954859..1955968
Genome map
AA seq 369 aa AA seqDB search
MKYKRIVFKVGTSSLTNEDGSLSRSKVKDITQQLAMLHEAGHELILVSSGAIAAGFGALG
FKKRPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQILLTQDDFVDKRRYKNAHQAL
SVLLNRGAIPIINENDSVVIDELKVGDNDTLSAQVAAMVQADLLVFLTDVDGLYTGNPNS
DPRAKRLERIETINREIIDMAGGAGSSNGTGGMLTKIKAATIATESGVPVYICSSLKSDS
MIEAAEETEDGSYFVAQEKGLRTQKQWLAFYAQSQGSIWVDKGAAEALSQHGKSLLLSGI
VEAEGAFSYGDIVTVFDKESGKSLGKGRVQFGASALEDILRSQKAKGVLIYRDDWISITP
EIQLLFTEF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaacggattgtctttaaggtgggtacttcttctctgacaaatgaggatgga
agtttatcacgtagtaaggtaaaggatattacccagcagttggctatgctgcacgaggct
ggtcatgagttgattttggtgtcttcaggtgccattgcggctggttttggagccttagga
tttaaaaagcgtccgactaaaattgctgataaacaggcttcagcagcggtagggcaggga
cttttgttggaagaatatacgaccaatcttctcttgcgtcaaatcgtttctgcacaaatc
ttgctgacccaagatgactttgtggataagcgtcgttataaaaatgcccatcaggctttg
tcggttttgctcaaccgtggggcaattcctatcatcaatgagaatgatagtgtcgttatt
gatgagctcaaggttggggacaatgacactctaagtgctcaagtagcggcgatggtccaa
gcagaccttttagttttcttgacagatgtggacggtctctatactggaaatcctaattca
gatccaagagccaaacgcttggagagaatcgagaccatcaatcgtgagattattgatatg
gctggtggagctggttcgtcaaacggaactgggggtatgttaaccaaaatcaaggctgca
actatcgcgacggaatcaggagttcctgtttatatctgctcatccttgaaatcagattcc
atgattgaggcggcagaggagaccgaggatggttcttactttgttgctcaagagaagggg
cttcgtacccagaaacaatggcttgccttctatgctcagagtcaaggttctatttgggtt
gataaaggggctgcggaagctctctctcaacatggaaagagtcttctcttatctggtatc
gttgaagcagaaggagccttttcttacggtgatatcgtgacagtatttgacaaggaaagt
ggaaaatcacttggaaaaggacgcgtgcaatttggagcatctgctttggaggatatattg
cgttctcaaaaagccaagggtgtcttgatttaccgtgacgactggatttccattactcct
gaaatccaactactttttacagaattttag

DBGET integrated database retrieval system