KEGG   Streptococcus pneumoniae gamPNI0373: HMPREF1038_00122Help
Entry
HMPREF1038_00122  CDS       T02334                                 

Gene name
strH
Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
spng  Streptococcus pneumoniae gamPNI0373
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spng00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF1038_00122 (strH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    HMPREF1038_00122 (strH)
Enzymes [BR:spng01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HMPREF1038_00122 (strH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(94959..98981)
Genome map
AA seq 1340 aa AA seqDB search
MTLVNIRNKIKALIYIIAINITMQSGGFAMKHEKQQRFSIRKYAVGAASVLIGFAFQAQT
VAADGVTTTTENQPTIHTVSDSPQSSENRTEETPKAELQPEAPKTVETETPATDKVASLP
KTEEKPQEEVSSTPSDKAEVVTPTSAEKETANKKAEEASPKKEEAKEVDSKESNTDKTDK
DKPAKKDEAKAEADKPETEAGKERAATVNEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAK
HYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTES
QMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQ
AVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYE
KFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSK
LLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGG
MVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVT
AVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTPEALKEEEAKREVEKLAKN
KVISIDAGRKYFTLNQLKRIVDKASELGYSDVHLLLGNDGLRFLLDDMTITANGKTYASD
DVKKAIIEGTKAYYDDPNGTALTQAEVTELIEYAKSKDIGLIPAINSPGHMDAMLVAMEK
LGIKNPQAHFDKVSKTTMDLKNEEAMNFVKALIGKYMDFFAGKTKIFNFGTDEYANDATS
AQGWYYLKWYQLYGKFAEYANTLAAMAKERGLQPMAFNDGFYYEDKDDVQFDKDVLISYW
SKGWWGYNLASPQYLASKGYKFLNTNGDWYYILGQKPEDGGGFLKKAIENTGKTPFNQLA
STKYPEVDLPTVGSMLSIWADRPSAEYKEEEIFELMTAFADHNKDYFRANYNALREELAK
IPTNLEGYSKESLEALDAAKTALNYNLNRNKQAELDTLVANLKAALQGLKPAATHSGSLD
ENEVAANVETRPELITRTEEIPFEVIKKENPNLPAGQENIITAGVKGERTHYISVLTENG
KTTETVLDSQVTKEVINQVVEVGAPVTHKGDESGLAPTTEVKPRLDIQKEEIPFTTVTRE
NPLLLKGKTQVITKGVNGHRSNFYSVSTSADGKEVKTLVNSVVAQEAVTQIVEVGTMVTH
VGDENGQAAIAEEKPKLEIPSQPAPSTAPAEESKALPQDPAPVVTEKKLPETGTHDSAGL
VVAGLMSTLAAYGLTKRKED
NT seq 4023 nt NT seq  +upstreamnt  +downstreamnt
ttgactctcgttaatataagaaataaaataaaggcgttgatttatataatcgctatcaat
ataacaatgcaatcaggaggttttgcaatgaaacatgaaaaacaacagcgtttttctatt
cgtaaatacgctgtaggagcagcttctgttctaattggatttgccttccaagcacagact
gttgcagccgatggagttactactactacagaaaaccaaccgaccatccatacagtttct
gattcccctcaatcatccgaaaatcggactgaggaaacacctaaagcagagcttcaacca
gaagctccaaaaactgtagaaacagaaactccagctactgataaggtagctagtcttcca
aaaacagaagaaaaaccacaagaggaagttagttcaactcctagtgataaagcagaggtg
gtaactccaacttctgctgaaaaagaaactgctaataaaaaggcagaagaagctagccct
aaaaaggaagaagcgaaagaggttgattctaaagagtcaaatacagacaagactgacaag
gataaaccagctaaaaaagatgaagcgaaagcagaggctgacaaaccggaaacagaggca
ggaaaggaacgtgctgcaactgtaaatgaaaaactagcgaaaaagaaaattgtttctatt
gatgctggacgtaaatatttctcaccagaacaactcaaggaaatcatcgataaagcgaaa
cattatggctacactgatttacacctattagtcggaaatgatggactccgtttcatgttg
gacgatatgagcatcacagctaacggcaagacctatgccagtgacgatgtcaaacgcgcc
attgaaaaaggtacaaatgattattacaacgatccaaacggcaatcacttaacagaaagt
caaatgacagatctgattaactatgccaaagataaaggtatcggtctcattccgacagta
aatagtcctggacacatggatgcgattctcaatgccatgaaagaattgggaatccaaaac
cctaactttagctattttgggaagaaatcagcccgtactgtcgatcttgacaacgaacaa
gctgtcgcttttacaaaagcccttatcgacaagtatgctgcttatttcgcgaaaaagact
gaaatcttcaacatcggacttgatgaatatgccaatgatgcgacagatgctaaaggttgg
agtgtgcttcaagctgataaatactatccaaacgaaggctaccctgtaaaaggctatgaa
aaatttattgcctacgccaatgacctcgctcgtattgtaaaatcgcacggtctcaaacca
atggcttttaacgacggtatctactacaatagcgacacaagctttggtagttttgacaaa
gacatcatcgtttctatgtggactggtggttggggaggctacgatgtcgcttcttctaaa
ctactagctgaaaaaggtcaccaaatccttaataccaatgatgcttggtactacgttctt
ggacgaaacgctgatggccaaggctggtacaatctcgatcaggggctcaatggtattaaa
aacacaccaatcacttctgtaccaaaaacagaaggagctgatatcccaatcatcggtggt
atggtagctgcttgggctgacactccatctgcacgttattcaccatcacgcctcttcaaa
ctcatgcgtcattttgcaaatgccaacgctgaatacttcgcagctgattatgaatctgca
gagcaagcacttaacgaggtaccaaaagacctgaaccgttatactgcagaaagcgtcacg
gccgtaaaagaagctgaaaaagctattcgctctctcgatagcaaccttagccgtgcccaa
caagatacgattgatcaagccattgctaaacttcaagaaactgtcaacaacttgaccctc
acgcctgaagctctaaaagaagaagaagctaaacgtgaggttgaaaaacttgccaaaaac
aaggtaatctcaatcgatgctggacgcaaatactttactctgaaccagctcaaacgcatc
gtagacaaggccagtgagctcggatattctgatgtccatctccttctaggaaatgacgga
cttcgctttctactcgatgatatgaccattactgccaacggaaaaacctatgctagtgat
gacgttaaaaaagctattatcgaaggaactaaagcttactacgacgatccaaacggtact
gcactaacacaggcagaagtaacagagctaattgaatacgctaaatctaaggacatcggt
ctcatcccagctattaacagtccaggtcacatggatgctatgctggttgccatggaaaaa
ttaggtattaaaaatcctcaagcccactttgataaagtttcaaaaacaactatggacttg
aaaaacgaagaagcgatgaactttgtaaaagccctcatcggtaaatacatggacttcttt
gcaggtaaaacaaagattttcaactttggtactgacgaatacgccaacgatgcgactagt
gcccaaggctggtactacctcaagtggtatcaactctatggcaaatttgccgaatatgcc
aacaccctcgcagctatggccaaagaaagagggcttcaaccaatggccttcaacgatggc
ttctactatgaagacaaggacgatgttcagtttgacaaagatgtcttgatttcttactgg
tctaaaggctggtggggatataacctcgcatcacctcaatacctagcaagcaaaggctat
aaattcttgaataccaacggtgactggtactacattcttggtcaaaaaccagaagatggt
ggtggtttcctcaagaaagctattgagaatactggaaaaacaccattcaatcaactagct
tctaccaaatatcctgaagtagatcttccaacagtcggaagtatgctttcaatctgggca
gatagaccaagcgctgagtacaaggaagaggaaatctttgaactcatgactgcctttgca
gaccacaacaaagactacttccgtgctaattataatgctctccgcgaagaattagctaaa
attcctacaaacttagaaggatatagtaaagaaagtcttgaggcccttgacgcagctaaa
acagctctaaattacaacctcaaccgtaataaacaagctgagcttgacacacttgtagcc
aacctaaaagccgctcttcaaggcctcaaaccagctgcaactcattcaggaagcctagat
gaaaatgaagtggctgccaatgttgaaaccagaccagaactcatcacaagaactgaagaa
attccatttgaagttatcaagaaagaaaatcctaacctcccagctggtcaggaaaatatt
atcacagcaggagtcaaaggtgaacgaactcattacatctctgtactcactgaaaatgga
aaaacaacagaaacagtccttgatagccaggtaaccaaagaagttataaaccaagtggtt
gaagttggcgctcctgtaactcacaagggtgatgaaagtggtcttgcaccaactactgag
gtaaaacctagactggatatccaaaaagaagaaattccatttaccacagtgactcgtgaa
aatccactcttactcaaaggaaaaacacaagtcattactaagggcgtcaatggacatcgt
agcaacttctactctgtgagcacttctgccgatggtaaggaagtgaaaacacttgtaaat
agtgtcgtagcacaggaagccgttactcaaatagtcgaagtcggaactatggtaacacat
gtaggcgatgaaaacggacaagccgctattgctgaagaaaaaccaaaactagaaatccca
agccaaccagctccatcaactgctcctgctgaggaaagcaaagctcttcctcaagatcca
gctcctgtggtaacagagaaaaaacttcctgaaacaggaactcacgattctgcaggacta
gtagtcgcaggactcatgtccacactagcagcctatggactcactaaaagaaaagaagac
taa

DBGET integrated database retrieval system