KEGG   Streptococcus pneumoniae gamPNI0373: HMPREF1038_00446Help
Entry
HMPREF1038_00446  CDS       T02334                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
spng  Streptococcus pneumoniae gamPNI0373
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:spng00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HMPREF1038_00446
Enzymes [BR:spng01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     HMPREF1038_00446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(394378..396816)
Genome map
AA seq 812 aa AA seqDB search
MIGNYLNLPEQKHLNSHLFMQRNFMEVYFSGTIERIIFENPSNFYRILLLEIDDTDAEDF
DDFEIIVTGTMADVIEGEDYTFWGQIVQHSKYGEQLQISRYDRAKPTSKGLVKYFSSSHF
KGIGLKTAQKIVDTYGENTIDEILQHPEKLEGIAGFSAKNREAFVSTLRLNYGTEMVLSK
LANYGIPNKLAFQIQDFYKEETLDVVENYPYQLVEDIKGLGFTIADQLAEELGIESQAPE
RFRAGLVHSLFQACMETGDTYVEARDLLEQTLTLLESSRPVELDPSQVAQELSYLIEEDK
VQQIDTKIFDNSLFFAEEGIRSHLIRILEKGKQKSQDLETIQKHITTVEQELGIEYDNIQ
KQAICDAIQNKVFILTGGPGTGKTTVINGIIAVYALLEGLDLRKKSNLPILLAAPTGRAA
RRMNELTGLPSATIHRHLGMTGDDDTSHLEDYLDADFIIVDEFSMVDTWLANQLFSNISS
NSKILIVGDSDQLPSVSPGQVLADLLHIPLIPQTRLEKIYRQSKESTIVTLASQIRQGIL
PADFTQKKADRSYFEIASGHIPATIEKILGVALRNGIPARDIQVLAPMYRGTAGIDAINQ
LMQDLLNPPQKDQLSFEAPQCHYRKRDKVIHLVNDAEINVFNGDLGAITDLIPGKYTESK
QDEIVIDFDGNEVSYPRNEWYKIRLAYAMSIHKSQGSEFPVVILPITSASRRMLERNLIY
TAITRAKSKLILLGELQAFDYATQHIGTARKTYLIERFSDLLENVEEKQQAVSETVTSSA
SEQSYILTEENWDRIPAMIGITDTDLKEIFGK
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgattggtaactatctaaacttaccagaacagaaacacctcaactctcacctattcatg
caaaggaattttatggaagtttatttttcaggaaccattgaacggattatttttgaaaat
cccagcaatttttatcgcatcctcctcctagaaatcgacgatacggacgcagaggatttt
gatgattttgaaatcattgtcacaggaaccatggctgatgtaattgagggcgaagactat
actttttgggggcaaattgtccagcactccaagtatggagaacaactgcaaatcagtcgt
tatgatcgcgcaaaaccaactagtaagggcttggtcaagtacttttcaagtagccatttc
aaggggattggtctcaagacagctcagaaaatcgtggatacctatggcgaaaataccatt
gacgaaattttgcaacacccagaaaagttagaaggcatcgcaggattctctgccaaaaat
cgcgaggctttcgtctccactctccgtctcaactacggaacggagatggttttgtccaaa
ctagccaactacggcattcccaacaaactagcctttcagattcaagacttttacaaggaa
gaaacccttgatgtggttgaaaattatccctaccagctggttgaggatatcaagggtttg
ggctttaccattgctgaccaactagctgaggaactaggcatcgaaagtcaggctcctgaa
cgcttccgcgccggtctagttcacagtctttttcaggcctgtatggaaacaggggacacc
tatgttgaagcacgggatttgctggaacaaacccttactctccttgagtcttcccgtccc
gtggaactagaccccagccaagttgcccaagagctctcctacctgatcgaagaagacaag
gttcagcagattgataccaagatctttgacaacagcctctttttcgctgaggaaggtatc
cgcagtcacttgattcgtatccttgaaaaaggaaaacagaagagccaagatttagaaact
attcaaaagcatatcactactgtcgagcaagagctgggaattgagtatgataacattcaa
aaacaggctatctgtgatgctatccagaataaggtctttatcctgacaggtggacctggt
actggtaagacaactgttatcaatgggatcatcgctgtttacgccctgttagagggactt
gacctcaggaagaaaagcaatctgcccattcttcttgctgctccaactggacgagccgct
cgccgcatgaatgaattgacaggtttgcctagcgcgaccatacaccgccacttgggaatg
acaggtgacgatgataccagtcatctggaagattacctagatgctgactttatcatcgtg
gatgaattctctatggtagatacttggctggccaatcaactcttctccaatatctcttct
aacagtaagatcctcatcgtaggtgacagtgatcagctaccttctgtcagtcctggacag
gttctagcggatctgcttcatattcctttgattcctcagactcgcttggaaaaaatttat
cgacaaagcaaagaatcaaccatcgtcaccctagctagtcagattcgacagggcatcttg
ccagctgatttcacccaaaaaaaagctgaccgttcctactttgaaattgctagtggccat
attcctgccaccattgaaaaaatcttaggtgtcgccctcagaaatggtattcctgcccgt
gatatccaagttctggctcctatgtaccgagggacggcagggattgatgctatcaatcag
ctcatgcaagacctgctcaatcccccacaaaaagatcaactcagttttgaagctcctcag
tgccactatcgtaagagagacaaggtcattcatttggttaacgatgctgaaatcaatgtc
tttaatggggatttaggagctatcacagacctgattcctggtaaatacaccgaatcgaaa
caagacgagattgtcattgattttgatggtaatgaagtctcttacccccgtaacgaatgg
tacaagattcgcttggcctatgccatgagtattcataagtctcagggaagtgagttccca
gttgtcatcctaccgattactagtgctagccgacgtatgctggagcgaaatctcatctac
acagccattacacgtgccaaaagcaaactcatcttactaggcgaattacaagccttcgac
tatgctacccaacacatcggaactgcccgaaaaacctatctgattgaacgcttcagtgat
ctactggagaatgttgaagaaaagcaacaagctgtctctgaaacagtcacatcaagtgcc
tctgaacaatcctacatcctaaccgaagaaaactgggaccgcatcccagccatgattggg
attacagacacagacctcaaagagatttttggaaaatag

DBGET integrated database retrieval system