KEGG   Streptococcus pneumoniae gamPNI0373: HMPREF1038_00695Help
Entry
HMPREF1038_00695  CDS       T02334                                 

Gene name
gki
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
spng  Streptococcus pneumoniae gamPNI0373
Pathway
spng00010  Glycolysis / Gluconeogenesis
spng00052  Galactose metabolism
spng00500  Starch and sucrose metabolism
spng00520  Amino sugar and nucleotide sugar metabolism
spng00521  Streptomycin biosynthesis
spng01100  Metabolic pathways
spng01110  Biosynthesis of secondary metabolites
spng01120  Microbial metabolism in diverse environments
spng01130  Biosynthesis of antibiotics
spng01200  Carbon metabolism
Module
spng_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spng_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spng00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF1038_00695 (gki)
   00052 Galactose metabolism
    HMPREF1038_00695 (gki)
   00500 Starch and sucrose metabolism
    HMPREF1038_00695 (gki)
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF1038_00695 (gki)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HMPREF1038_00695 (gki)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HMPREF1038_00695 (gki)
Enzymes [BR:spng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HMPREF1038_00695 (gki)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: AFS42762
Position
640709..641686
Genome map
AA seq 325 aa AA seqDB search
MKKENMMSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDEGSHIVDDMIESIQHR
LDLLGLAAADFQGIGMGSPGVVDREKGTVIGAYNLNWKTLQPIKQKIEKALGIPFFIDND
ANVAALGERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGELGHITVDFDQP
ISCTCGKKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDNGEEVTAKTVFDLAKEGD
DLALIVYRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLQGVQKVYDENSFPQVR
TSTKLALATLGNDAGVIGAASLVLQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggagaatatgatgagtcaaaagattattgggattgaccttggtggaacttct
atcaaatttgcaatcttaacaacagcaggagaaatccaaggaaaatggtcaatcaagacc
aacattttggatgagggaagtcatatcgttgatgatatgattgagtctattcaacatcgt
ttggacttgcttggattggcagcagcggacttccaaggtattggaatgggatcaccaggt
gtggttgaccgtgaaaaagggactgttatcggtgcctacaacttgaactggaaaaccctt
caaccaatcaaacaaaagattgaaaaagctttgggcattccatttttcatcgataatgat
gccaacgtagcagctcttggtgagcgctggatgggtgctggagataaccaaccagacgtt
gtctttatgacactcggtactggtgttggtggtggtattgtcgcagaaggcaaattgctt
catggtgttgctggtgcagcaggtgaacttggtcatatcactgttgactttgaccaacca
atctcatgtacttgtggtaaaaaaggctgccttgagacagttgcttcagcaacagggatt
gtcaacttgactcgtcgctatgccgatgaatacgaaggcgatgcagccttgaaacgcttg
attgataacggagaagaagtaactgctaagactgtctttgatctcgcaaaagaaggagac
gaccttgctttgattgtttaccgtaacttctcacgttacttgggaatcgcttgtgctaac
attggttcaatcctaaacccatcaacaatcgtcatcggtggtggtgtgtcagctgcggga
gaattccttctacaaggtgttcaaaaagtttacgatgaaaatagtttcccacaagtacgc
acatctactaaattagctcttgcaactctaggaaatgacgctggagttatcggagcagca
tcacttgtattgcaataa

DBGET integrated database retrieval system