KEGG   Streptococcus pneumoniae gamPNI0373: HMPREF1038_00914Help
Entry
HMPREF1038_00914  CDS       T02334                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
spng  Streptococcus pneumoniae gamPNI0373
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:spng00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF1038_00914
   01230 Biosynthesis of amino acids
    HMPREF1038_00914
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF1038_00914
   00030 Pentose phosphate pathway
    HMPREF1038_00914
   00051 Fructose and mannose metabolism
    HMPREF1038_00914
   00052 Galactose metabolism
    HMPREF1038_00914
  Energy metabolism
   00680 Methane metabolism
    HMPREF1038_00914
Enzymes [BR:spng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HMPREF1038_00914
Protein phosphatases and associated proteins [BR:spng01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HMPREF1038_00914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
837285..838292
Genome map
AA seq 335 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDI
ISRGGTFLHSARYPEFAQLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAI
GLPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWA
GIATGADEIIIPEAGFKMEDIVASIKAGYECGKKHNIIVLAEGVMSAAEFGQKLKEAGDT
SDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGIGGVAVGIRNEKMVENPILGT
AEEGALFSLTAEGKIVVNNPHKADIELSSLNKSLS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgactagtggcggagacgcacctggtatgaacgctgctatc
cgtgcagttgttcgtcaagcaatttcagaaggaatggaagtgtttggtatctatgacgga
tatgctggtatggttgccggtgaaattcatcccctagatgcagcttcagtaggagacatc
atttctcgtggtggtacttttcttcactcagctcgttacccagagttcgctcaacttgaa
gggcaacttaaagggattgagcaattgaaaaaacacggaattgaaggtgtagttgttatc
ggtggtgacggatcttaccacggcgctatgcgtttgactgaacatggcttcccagctatt
ggtcttccaggtacaatcgataacgatatcgttggtactgactttacaatcggttttgac
acagcggttactactgccatggacgctatcgataagattcgtgatacatcatcaagtcac
cgtcgtacttttgtaatcgaagttatgggacgtaacgctggtgatatcgctctttgggct
ggtattgcaactggtgctgatgaaatcatcatccctgaagcaggcttcaagatggaagat
atcgtagcaagcatcaaagctggttatgaatgtggtaaaaaacacaatatcatcgtctta
gctgaaggtgtgatgtcagcggctgaatttggtcaaaaacttaaagaagctggagataca
agcgaccttcgtgtaacagaacttggacatattcaacgtggtggttctccaactgcgcgt
gaccgtgttttggcgtcacgtatgggtgcacatgctgttaaacttcttaaagaaggtatc
ggtggtgttgcggttggtattcgtaacgaaaaaatggttgaaaatccaattcttggtact
gcagaagaaggggcattgtttagccttactgcagaaggtaagattgtggttaacaacccg
cacaaagccgatattgagctatctagcttgaataagagcttgtcataa

DBGET integrated database retrieval system