KEGG   Streptococcus pneumoniae gamPNI0373: HMPREF1038_01034Help
Entry
HMPREF1038_01034  CDS       T02334                                 

Definition
acetoin dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
spng  Streptococcus pneumoniae gamPNI0373
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:spng01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:spng00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:spng00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:spng00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
941204..942247
Genome map
AA seq 347 aa AA seqDB search
MADDKLRATPAARKLADDLGINLYDVSGSGANGRVHKEDVETYKDTNVVRISPLAKRIAL
EHNIAWQEIQGTGHRGKIMKKDVLALLPENIENDSIKSPAQIEKVEEVPDNVTPYGEIER
IPMTPMRKVIAQRMVESYLTAPTFTLNYEVDMTEMLALRKKVLEPIMEATGKKTTVTDLL
SLAVVKTLMKHPYINASLTEDGKTIITHNYVNLAMAVGMDNGLMTPVVYNAEKMSLSELV
VAFKDVIGRTLDGKLAPSELQNSTFTISNLGMFGVQSFGPIINQPNSAILGVSSTIEKPV
VVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKELIETPISMLI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgacaagctaagagcgactcctgcagctagaaagttagcggatgatttaggg
ataaacctctacgacgtttctggctcaggtgcaaacggtcgtgtccacaaagaagacgtg
gaaacttataaagacacaaacgtggttcgcatttcgccacttgcaaaacgaattgccctc
gaacataacattgcttggcaggaaatccaaggaaccggtcatcgtggtaaaatcatgaag
aaggatgttttggccctgcttcctgaaaatatcgaaaacgatagcatcaaatctcctgct
cagattgaaaaagtggaagaagttcctgataacgtaacaccatatggtgaaatcgagcgt
attccaatgacaccaatgcgtaaggttattgcccaacgcatggttgaatcttacttgact
gcgccaaccttcaccctcaactatgaagttgatatgactgaaatgttggctcttcgtaag
aaggttcttgagccaatcatggaagcaactgggaagaagactactgtaacagaccttctt
tcgcttgcagttgttaagactcttatgaaacacccatacatcaacgcttcattgacagaa
gatggcaagactattatcactcacaactatgtcaatcttgccatggcagttgggatggat
aatggattgatgacacctgttgtttacaatgctgagaagatgagtctttcagaactggtt
gtagcctttaaggatgttattggccgtaccttggatggtaaattggctccaagtgagtta
caaaattcaacattcacaatcagtaatttgggaatgtttggtgttcagtcctttggcccg
attattaaccaacccaactcagctatccttggtgtcagttcgacaatcgagaagccagtt
gtcgtcaatggtgaaattgtgattcgcccaatcatgagtttaggattaaccattgaccac
cgtgtcgtagatggtatggctggtgctaagtttatgaaggacttgaaagagttgattgaa
acgccaatctcaatgttaatttaa

DBGET integrated database retrieval system