KEGG   Streptococcus pneumoniae gamPNI0373: HMPREF1038_01058Help
Entry
HMPREF1038_01058  CDS       T02334                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
spng  Streptococcus pneumoniae gamPNI0373
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spng00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF1038_01058
Enzymes [BR:spng01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     HMPREF1038_01058
Exosome [BR:spng04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF1038_01058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(980044..981972)
Genome map
AA seq 642 aa AA seqDB search
MDNREALKTFMTGENFYLQHYLGAHREELNGEHGYTFRVWAPNAQAVHLVGDFTNWIENQ
IPMVRNDFGVWEVFTNMAQEGHIYKYHVTRQNGHQLMKIDPFAVRYEARPGTGAILTELP
EKKWKDGLWLARRKRWGFEERPVNIYEVHAGSWKRNSDGSPYSFAQLKDELIPYLVEMNY
THIEFMPLMSHPLGLSWGYQLMGYFALEHAYGRPEEFQDFVEECHTHNIGVIVDWVPGHF
TINDDALAYYDGTPTFEYQDHNKAHNHGWGALNFDLGKNEVQSFLISCIKHWIDVYHLDG
IRVDAVSNMLYLDYDNAPWTPNKDGGNLNYEGYYFLQRLNEVIKLEYPDVMMIAEESSSA
TKITGMKEIGSLGFDYKWNMGWMNDILRFYEEDPIYRKYDFNLVTFSFMYVFKENYLLPF
SHDEVVHGKKSMMHKMWGDRYNQFAGLRNLYTYQICHPGKKLLFMGSEYGQFLEWKSEEQ
LEWSNLEDPMNAKMKYFASQLNQFYKDHRCLWEIDTSYDGIEIIDADNRDQSVLSFIRKG
KKGEMLVCIFNMVPVERKDFTIGLPVAGIYEEVWNTELEEWGGVWKEHNQTVQTQEGLWK
DYEQTLTFTLPAMGASVWKIKRRLKSTKTVTNKNQKGVENEK
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggataatagagaagcattaaaaacctttatgacgggtgaaaatttttatctccaacat
tatctaggagcacatagggaagaactaaatggagagcatggctataccttccgtgtttgg
gcacctaatgctcaggctgttcacttggttggtgattttaccaactggattgaaaatcag
attccaatggtaagaaatgattttggggtctgggaagtctttaccaatatggctcaagaa
gggcatatttacaaatatcatgtcacacgtcaaaatggtcatcaactgatgaagattgac
ccttttgctgtcaggtatgaggctcgtccaggaacaggggcaatcttaacagagcttcct
gagaagaaatggaaggatggactttggctggcacgaagaaaacgttggggctttgaagag
cgtcctgtcaatatttatgaagttcacgctggatcatggaaaagaaattctgatggcagt
ccttatagttttgcccagctcaaggatgaactcattccttatctcgttgaaatgaactat
actcatattgagtttatgcccttgatgtcccatcctttgggcttgagttgggggtatcag
cttatgggttacttcgctttagagcatgcttatggcagaccagaggagtttcaagatttt
gtcgaggagtgtcatacccataatattggggttattgtggactgggtaccaggtcacttt
accatcaacgatgatgccttagcctattatgatgggacaccgacttttgaataccaagac
cataataaggctcataaccatggttggggtgcccttaattttgaccttggaaaaaatgaa
gtccagtccttcttaatttcttgcattaagcattggattgatgtctatcatttggatggt
attcgtgtggatgctgttagcaacatgctctatttggactatgataatgctccatggaca
cctaataaagatggcggaaatctcaactatgaaggttattattttcttcaacgcttgaat
gaagttattaagttagaatatccagatgtgatgatgattgcagaagaaagttcgtctgcg
accaagattacgggaatgaaagagattggtagtctaggatttgactacaaatggaacatg
ggctggatgaatgatatcctccgtttctacgaagaagatccgatttatcgtaaatatgac
tttaacctggtgactttcagctttatgtatgttttcaaggagaattatctcttgccattc
tcgcacgatgaagtggttcatggcaagaagagtatgatgcataagatgtggggagatcgt
tacaatcaattcgcaggcttgcgcaatctctatacgtaccaaatttgtcaccctggtaag
aaattgctcttcatgggtagcgaatacggtcaattcctagaatggaaatctgaagaacag
ttggaatggtctaacctagaagacccaatgaatgctaagatgaagtatttcgcttctcag
ctaaaccagttttacaaagatcatcgctgtctgtgggaaattgataccagctatgatggt
attgaaatcattgatgcggataatcgagaccagagtgttctttcctttattcgtaagggt
aaaaagggagaaatgttagtctgtatctttaatatggtacctgttgagcggaaagatttt
acaatcggactacccgttgcaggaatttacgaagaagtatggaatactgagttggaagag
tggggaggcgtttggaaagaacataatcaaactgttcaaacgcaagaaggactatggaaa
gattatgagcagaccttaacctttactctaccggctatgggagcaagtgtatggaaaatc
aaacgtcgcttgaaatctactaaaaccgtcacaaataaaaaccaaaaaggagtagaaaat
gaaaaatga

DBGET integrated database retrieval system