KEGG   Streptococcus pneumoniae gamPNI0373: HMPREF1038_01788Help
Entry
HMPREF1038_01788  CDS       T02334                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
spng  Streptococcus pneumoniae gamPNI0373
Pathway
spng00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spng01100  Metabolic pathways
spng01110  Biosynthesis of secondary metabolites
spng01130  Biosynthesis of antibiotics
spng01230  Biosynthesis of amino acids
Module
spng_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spng00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF1038_01788 (trpC)
Enzymes [BR:spng01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HMPREF1038_01788 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS Rho_N NeuB DUF5390
Motif
Other DBs
NCBI-ProteinID: AFS43810
Position
complement(1644674..1645441)
Genome map
AA seq 255 aa AA seqDB search
MSQEFLARILEQKVREVEQMKLEQIQPLRQTYRLAEFLKNHQDRLQVIAEVKKASPSLGD
INLDVDIVQQAQTYEENGAVMISVLTDEVFFKGHLDYLREISSQVEIPTLNKDFIIDEKQ
IIRARNAGATVILLIVAALSEERLKELYDYATELGLEVLVETHNLAELEVAHRLGAEIIG
VNNRNLTTFEVDLQTSVDLAPYFEEGRYYISESAIFTGQDAERLAPYFNGILVGTALMQA
ENVAQRIKELQIDKG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggaatttttagcacgaatcttagagcagaaggtgcgtgaggtggagcagatg
aagctggagcaaatccagcctctgcgccagacctatcgcttggcagaatttttgaagaat
catcaggaccgcttgcaggtaatcgctgaggtcaagaaagctagccctagtttgggagat
atcaatctcgatgtggatattgtgcaacaggcccagacttatgaagaaaacggagcagtg
atgatttcggtgttgacagatgaggttttctttaaagggcatttggattatctacgggaa
atttccagtcaggtagagattccgacgctcaacaaagactttatcatcgatgaaaagcaa
atcatccgcgctcgcaatgcaggtgcgacagttatcttgctcattgtggcagccttgtcc
gaagaacgcctcaaggaactgtatgactacgcgacagagcttggtctggaagtcttagtg
gagactcacaatctagctgaactagaggtagcccacagacttggtgctgagattatcggg
gtcaacaaccgcaacttgactacctttgaggtcgacttgcagaccagtgtagatttagcc
ccttactttgaggaaggtcgctattacatttctgaatctgccattttcacagggcaggat
gcggaacgactagccccatactttaacggaattttggtagggacagctcttatgcaggca
gaaaatgtggcccagagaatcaaggagttgcagattgacaaaggttaa

DBGET integrated database retrieval system