KEGG   Streptococcus pneumoniae gamPNI0373: HMPREF1038_01866Help
Entry
HMPREF1038_01866  CDS       T02334                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
spng  Streptococcus pneumoniae gamPNI0373
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:spng00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF1038_01866
Enzymes [BR:spng01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     HMPREF1038_01866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1716799..1718244)
Genome map
AA seq 481 aa AA seqDB search
MMPIQNKTMLITYSDSLGNNLKDLYDNLEEHFGDAIGGVHLLPFFPSTGDRGFAPVDYDE
VDSAFGDWEDVKRLGERYYLMFDFMINHISRQSKYYKDYQEKHEASEFKALFLNWDKFWP
ENRPTQSDVDLIYKRKDRAPKQEIVFEDGSVEHLWNTFGEEQIDLDVTKEVTMEFIRKTI
QHLASNGCDLIRLDAFAYAVKKLDTNDFFVEPDIWDLLDKVRDIAAEYGTELLPEIHEHY
SIQFKIADHDYYVYDFALPMVTLYTLYSSRTERLAKWLKMSPMKQFTTLDTHDGIGVVDV
KDILTDEEIDYASNELYKVGANVKRKYSSAEYNNLDIYQINSTYYSALGDDDVKYFLARL
IQAFAPGIPQVYYVGLLAGKNDLKLLEETKEGRNINRHYYSNEEIAKEVQRPVVKALLNL
FSFRNRSEAFDLEGTTEIETPTAHSIVIKRQNKDKSVTAVAEIDLQNQTYRVIENGVEVT
F
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgatgccaattcaaaataaaaccatgttgattacctattctgatagccttggaaataat
cttaaagacttatatgataatttggaagagcattttggagatgctattggaggagttcac
cttttaccatttttcccatcaacaggtgatcgtggatttgcgccagttgactacgacgaa
gtggactcagcttttggtgattgggaggatgttaagcgtttaggtgagagatattatctt
atgtttgattttatgattaatcatatttctcgtcaatccaagtattataaggactatcaa
gaaaaacatgaagccagtgaatttaaagctctctttttaaactgggataagttttggcca
gaaaaccgtccgacacagtctgatgtagatttaatttacaagcgtaaggatcgtgcacca
aagcaagagattgtgtttgaagatggttcagtggaacatttgtggaatacctttggtgag
gagcagattgatcttgatgtgaccaaagaagtaactatggaatttatccgtaagaccatt
cagcacttggcaagtaatgggtgtgatttgattcgtctagatgcctttgcttatgcagtg
aagaaattggatactaatgatttctttgtggaaccagatatttgggatttattggacaaa
gttcgagatatcgctgctgagtatgggacagagcttttacctgagattcatgaacactat
tcgattcagtttaaaatagcagaccatgattactatgtttatgattttgctcttccaatg
gtgacactttatactctttacagttccagaacagagcgtttggctaagtggttaaagatg
agcccgatgaagcaatttacgacgctagatacccatgatgggattggagtagtagatgtc
aaggatatcctgaccgatgaggagattgactatgcttcaaatgaactctataaggttgga
gccaatgtcaaacgtaagtactctagtgccgagtataacaacttagatatctaccaaatc
aattcaacctactattcagcgcttggagatgatgatgtcaagtattttctcgctcgtcta
attcaagcttttgccccaggtattcctcaggtttactatgtgggtctattagcaggcaag
aatgacttgaaattattagaagaaactaaagaaggtcgaaatattaatcgtcattactat
agcaacgaggaaatagcaaaagaagtgcaacgacctgttgtgaaggcccttctcaatcta
ttttctttccgtaaccgttcagaagcctttgatctagaagggactactgagatagagaca
ccaacagctcacagcattgtaatcaaacgtcaaaataaagataagtccgtaacagcagta
gcagaaattgatttgcaaaatcagacttatcgggtaattgagaatggagttgaagtaaca
ttttga

DBGET integrated database retrieval system