KEGG   Streptococcus pneumoniae gamPNI0373: HMPREF1038_02021Help
Entry
HMPREF1038_02021  CDS       T02334                                 

Definition
(RefSeq) aldehyde-alcohol dehydrogenase 2
  KO
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
spng  Streptococcus pneumoniae gamPNI0373
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spng00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HMPREF1038_02021
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF1038_02021
   00620 Pyruvate metabolism
    HMPREF1038_02021
   00650 Butanoate metabolism
    HMPREF1038_02021
  Lipid metabolism
   00071 Fatty acid degradation
    HMPREF1038_02021
  Amino acid metabolism
   00350 Tyrosine metabolism
    HMPREF1038_02021
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HMPREF1038_02021
   00626 Naphthalene degradation
    HMPREF1038_02021
Enzymes [BR:spng01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HMPREF1038_02021
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     HMPREF1038_02021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1840708..1843371)
Genome map
AA seq 887 aa AA seqDB search
MEENMADKKTVTPEEKKLVAEKHVDELVQKALVALEEMRKLDQEQVDYIVAKASVAALDA
HGELALHAFEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDDVTGLTLIAEPVG
VVCGITPTTNPTSTAIFKSLISLKTRNPIVFAFHPSAQESSAHAARIVRDAAIAAGAPEN
CVQWITQPSMEATSALMNHEGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSA
NIRQAAHDIVMSKSFDNGMVCASEQAVIIDKEIYDEFVAEFKSYHTYFVNKKEKALLEEF
CFGVKANSKNCAGAKLNADIVGKPATWIAEQAGFTVPEGTNILAAECKEVGENEPLTREK
LSPVIAVLKSESREDGITKARQMVEFNGLGHSAAIHTADEELTKEFGKAVKAIRVICNSP
STFGGIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGRRRNNMQWMKLPSKT
YFERDSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEPDPD
ITTVNRGTEIMRAFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAF
KFPLLGKKTKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLT
VPGFVAADTGMDVLTHATEAYVSQMASDYTDGLALQAIKLVFENLESSVKNADFHSREKM
HNASTIAGMAFANAFLGISHSMAHKIGAQFHTIHGRTNAILLPYVIRYNGTRPAKTATWP
KYNYYRADEKYQDIARMLGLPASTPEEGVESYAKAVYELGERIGIQMNFRDQGIDEKEWK
EHSRELAFLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYKERPGRRK
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaaatatggctgataaaaaaactgtgacaccagaggaaaagaaactcgttgct
gaaaaacacgtagatgagttggttcaaaaagctctagttgcccttgaagaaatgcgtaaa
ttggatcaagaacaagttgactacatcgttgccaaagcatcagtagcagctttggatgcc
cacggagaattggctttacatgcctttgaagaaacaggacgtggtgtatttgaagacaaa
gcaactaagaacttgtttgcttgtgaacacgtagtaaacaacatgcgccacactaagaca
gttggcgttatcgaagaagacgatgtaacaggattgactcttattgctgaaccagttggt
gttgtttgtggtattactccaacaacaaacccaacatcaacagcaatcttcaaatcattg
atttcattgaagacacgtaacccaatcgtctttgccttccatccatcagcacaagaatca
tctgctcatgcagctcgtatcgtccgcgatgcagctatcgcagctggtgctcctgaaaac
tgtgtacagtggatcactcaaccatctatggaagcaactagtgcccttatgaaccacgaa
ggtattgcaacaatccttgcaacaggtggtaatgccatggttaaagccgcatactcatgt
ggtaaaccagctcttggggtaggtgccggaaacgttccagcttatgttgaaaaatcagca
aacattcgtcaagcagcacacgatatcgtcatgtctaaatcatttgataacggtatggtc
tgtgcatctgaacaagcagttatcattgataaagaaatttacgatgaatttgtagcagag
ttcaaatcttaccacacttactttgtaaacaaaaaagaaaaagctcttcttgaagagttc
tgcttcggcgtcaaagcaaacagcaaaaactgtgctggtgcaaaattgaacgctgacatc
gttggtaaaccagcaacttggattgcagaacaagcaggatttacagttccagaaggaaca
aacattcttgctgcagaatgtaaagaagttggcgaaaatgagccattgactcgtgaaaaa
ttgtcaccagttattgcagttttgaaatctgaaagccgtgaagatggtattactaaggct
cgtcaaatggttgaatttaacggtcttggacactcagcagctatccacacagctgacgaa
gaattgactaaagaatttggtaaagctgttaaagctattcgtgttatctgtaactcacct
tctacttttggtggtatcggggacgtttacaatgccttcttgccatcattgacacttgga
tgtggttcttacggacgcaactcagttggggataacgttagtgccattaacctcttgaat
atcaaaaaagtcggaagacggagaaataacatgcaatggatgaaacttccttcaaaaaca
tactttgaacgtgattcaattcaataccttcaaaaatgtcgtgacgttgaacgtgtcatg
atcgttactgaccatgccatggtagagcttggtttccttgatcgtatcatcgaacaactg
gaccttcgtcgcaataaggttgtttaccaaatctttgcggatgtagaaccggatccagat
atcacaactgtaaaccgtggtactgagattatgcgtgccttcaaaccagataccatcatc
gcactcggtggtgggtctccaatggatgctgccaaagtaatgtggctcttctacgagcaa
ccagaagtggacttccgtgaccttgtccaaaaattcatggatatccgtaaacgtgccttc
aagttcccattgcttggtaagaagactaaattcatcgcgattccaactacatctggtaca
ggatctgaagtaacaccatttgccgttatctctgataaagcaaacaaccgtaaataccca
atcgctgactactcattgacaccaactgtggcaatcgtagatcctgctttggtattgaca
gttccaggatttgttgctgctgatactggtatggacgtattgactcacgcgacagaagca
tacgtatcacaaatggctagtgactacactgatggtttagcacttcaagccattaaattg
gtctttgaaaatctcgaaagctcagttaagaatgcagacttccactcacgtgagaaaatg
cataacgcttcaacaatcgctggtatggcctttgccaatgccttcctaggtatttctcac
tcaatggcccataagattggtgcgcaattccacacaatccacggtcgtacaaatgctatc
ttgcttccatacgttatccgttacaacggtacacgtccagctaagacagcaacatggcct
aagtacaactactaccgtgcagatgaaaaataccaagatatcgcacgcatgcttggactt
ccagcttctactccagaagaaggggttgaatcttacgcaaaagctgtctacgaactcggt
gaacgtattgggatccaaatgaattttagagaccaaggaattgacgaaaaagaatggaaa
gaacattctcgtgaattagccttcctggcttatgaagaccaatgttcaccagctaaccca
cgtcttccaatggtagaccatatgcaagaaatcatcgaagatgcatactatggctacaaa
gaaagaccaggacgccgtaaataa

DBGET integrated database retrieval system