KEGG   Streptococcus pneumoniae gamPNI0373: HMPREF1038_02021Help
Entry
HMPREF1038_02021  CDS       T02334                                 

Definition
aldehyde-alcohol dehydrogenase 2
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
spng  Streptococcus pneumoniae gamPNI0373
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spng00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HMPREF1038_02021
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF1038_02021
   00620 Pyruvate metabolism
    HMPREF1038_02021
   00650 Butanoate metabolism
    HMPREF1038_02021
  Lipid metabolism
   00071 Fatty acid degradation
    HMPREF1038_02021
  Amino acid metabolism
   00350 Tyrosine metabolism
    HMPREF1038_02021
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HMPREF1038_02021
   00626 Naphthalene degradation
    HMPREF1038_02021
Enzymes [BR:spng01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HMPREF1038_02021
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     HMPREF1038_02021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1840708..1843371)
Genome map
AA seq 887 aa AA seqDB search
MEENMADKKTVTPEEKKLVAEKHVDELVQKALVALEEMRKLDQEQVDYIVAKASVAALDA
HGELALHAFEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDDVTGLTLIAEPVG
VVCGITPTTNPTSTAIFKSLISLKTRNPIVFAFHPSAQESSAHAARIVRDAAIAAGAPEN
CVQWITQPSMEATSALMNHEGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSA
NIRQAAHDIVMSKSFDNGMVCASEQAVIIDKEIYDEFVAEFKSYHTYFVNKKEKALLEEF
CFGVKANSKNCAGAKLNADIVGKPATWIAEQAGFTVPEGTNILAAECKEVGENEPLTREK
LSPVIAVLKSESREDGITKARQMVEFNGLGHSAAIHTADEELTKEFGKAVKAIRVICNSP
STFGGIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGRRRNNMQWMKLPSKT
YFERDSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEPDPD
ITTVNRGTEIMRAFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAF
KFPLLGKKTKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLT
VPGFVAADTGMDVLTHATEAYVSQMASDYTDGLALQAIKLVFENLESSVKNADFHSREKM
HNASTIAGMAFANAFLGISHSMAHKIGAQFHTIHGRTNAILLPYVIRYNGTRPAKTATWP
KYNYYRADEKYQDIARMLGLPASTPEEGVESYAKAVYELGERIGIQMNFRDQGIDEKEWK
EHSRELAFLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYKERPGRRK
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaaatatggctgataaaaaaactgtgacaccagaggaaaagaaactcgttgct
gaaaaacacgtagatgagttggttcaaaaagctctagttgcccttgaagaaatgcgtaaa
ttggatcaagaacaagttgactacatcgttgccaaagcatcagtagcagctttggatgcc
cacggagaattggctttacatgcctttgaagaaacaggacgtggtgtatttgaagacaaa
gcaactaagaacttgtttgcttgtgaacacgtagtaaacaacatgcgccacactaagaca
gttggcgttatcgaagaagacgatgtaacaggattgactcttattgctgaaccagttggt
gttgtttgtggtattactccaacaacaaacccaacatcaacagcaatcttcaaatcattg
atttcattgaagacacgtaacccaatcgtctttgccttccatccatcagcacaagaatca
tctgctcatgcagctcgtatcgtccgcgatgcagctatcgcagctggtgctcctgaaaac
tgtgtacagtggatcactcaaccatctatggaagcaactagtgcccttatgaaccacgaa
ggtattgcaacaatccttgcaacaggtggtaatgccatggttaaagccgcatactcatgt
ggtaaaccagctcttggggtaggtgccggaaacgttccagcttatgttgaaaaatcagca
aacattcgtcaagcagcacacgatatcgtcatgtctaaatcatttgataacggtatggtc
tgtgcatctgaacaagcagttatcattgataaagaaatttacgatgaatttgtagcagag
ttcaaatcttaccacacttactttgtaaacaaaaaagaaaaagctcttcttgaagagttc
tgcttcggcgtcaaagcaaacagcaaaaactgtgctggtgcaaaattgaacgctgacatc
gttggtaaaccagcaacttggattgcagaacaagcaggatttacagttccagaaggaaca
aacattcttgctgcagaatgtaaagaagttggcgaaaatgagccattgactcgtgaaaaa
ttgtcaccagttattgcagttttgaaatctgaaagccgtgaagatggtattactaaggct
cgtcaaatggttgaatttaacggtcttggacactcagcagctatccacacagctgacgaa
gaattgactaaagaatttggtaaagctgttaaagctattcgtgttatctgtaactcacct
tctacttttggtggtatcggggacgtttacaatgccttcttgccatcattgacacttgga
tgtggttcttacggacgcaactcagttggggataacgttagtgccattaacctcttgaat
atcaaaaaagtcggaagacggagaaataacatgcaatggatgaaacttccttcaaaaaca
tactttgaacgtgattcaattcaataccttcaaaaatgtcgtgacgttgaacgtgtcatg
atcgttactgaccatgccatggtagagcttggtttccttgatcgtatcatcgaacaactg
gaccttcgtcgcaataaggttgtttaccaaatctttgcggatgtagaaccggatccagat
atcacaactgtaaaccgtggtactgagattatgcgtgccttcaaaccagataccatcatc
gcactcggtggtgggtctccaatggatgctgccaaagtaatgtggctcttctacgagcaa
ccagaagtggacttccgtgaccttgtccaaaaattcatggatatccgtaaacgtgccttc
aagttcccattgcttggtaagaagactaaattcatcgcgattccaactacatctggtaca
ggatctgaagtaacaccatttgccgttatctctgataaagcaaacaaccgtaaataccca
atcgctgactactcattgacaccaactgtggcaatcgtagatcctgctttggtattgaca
gttccaggatttgttgctgctgatactggtatggacgtattgactcacgcgacagaagca
tacgtatcacaaatggctagtgactacactgatggtttagcacttcaagccattaaattg
gtctttgaaaatctcgaaagctcagttaagaatgcagacttccactcacgtgagaaaatg
cataacgcttcaacaatcgctggtatggcctttgccaatgccttcctaggtatttctcac
tcaatggcccataagattggtgcgcaattccacacaatccacggtcgtacaaatgctatc
ttgcttccatacgttatccgttacaacggtacacgtccagctaagacagcaacatggcct
aagtacaactactaccgtgcagatgaaaaataccaagatatcgcacgcatgcttggactt
ccagcttctactccagaagaaggggttgaatcttacgcaaaagctgtctacgaactcggt
gaacgtattgggatccaaatgaattttagagaccaaggaattgacgaaaaagaatggaaa
gaacattctcgtgaattagccttcctggcttatgaagaccaatgttcaccagctaaccca
cgtcttccaatggtagaccatatgcaagaaatcatcgaagatgcatactatggctacaaa
gaaagaccaggacgccgtaaataa

DBGET integrated database retrieval system