KEGG   Streptococcus pneumoniae gamPNI0373: HMPREF1038_02079Help
Entry
HMPREF1038_02079  CDS       T02334                                 

Definition
glutamate--tRNA ligase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
spng  Streptococcus pneumoniae gamPNI0373
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:spng00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    HMPREF1038_02079
Enzymes [BR:spng01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     HMPREF1038_02079
Amino acid related enzymes [BR:spng01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   HMPREF1038_02079
Transfer RNA biogenesis [BR:spng03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    HMPREF1038_02079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1886709..1888169)
Genome map
AA seq 486 aa AA seqDB search
MSKDIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGTFLIRIEDTDRKRHVEDGERSQL
ENLRWLGMDWDESPESHENYRQSERLDLYQKYIDQLLAEGKAYKSYVTEEELAAERERQE
VAGETPRYINEYLGMSEEEKAAYIAEREAAGIIPTVRLAVNESGIYKWHDMVKGDIEFEG
GNIGGDWVIQKKDGYPTYNFAVAIDDHDMQISHVIRGDDHIANTPKQLMVYESLGWEAPE
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYLPEAVFNFIALLGWNPGGEDEIFSR
EELIKLFDENRLSKSPAAFDQKKLDWMSNDYIKNADLETIFEMAKPFLEEAGRLTDKAEK
LVELYKPQMKSVDEIIPLTDLFFSDFPELTEAEREVMTGETVPTVLEAFKAKLEAMTDDK
FVTENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPDTIFLLGREKSIQHIENM
LKEISK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagatatccgcgtacgttacgcaccaagtccaacaggactactacacatcgga
aatgctcgtacagcattgtttaattacttgtatgcgcgccatcatggtggaacatttctc
atccgtatcgaagatactgaccgtaaacgccatgtcgaggatggtgaacgttcacaactt
gaaaaccttcgctggttaggcatggattgggatgaaagtccagaatcacatgagaattat
cgccagtctgagcgtttagacttgtatcaaaaatacattgaccaactattagctgaagga
aaagcctataaatcttacgttacagaagaagagttggcagctgaacgcgaacgccaagaa
gtagctggcgaaacaccacgctacatcaatgaataccttggtatgagtgaagaagaaaaa
gcagcttacatcgcagaacgtgaagcagcagggatcatcccaactgttcgtttggctgtc
aatgagtcaggtatctacaagtggcatgatatggtcaaaggcgatatcgaatttgaaggt
ggcaatatcggtggtgactgggttatccaaaagaaagacggttacccaacttacaacttt
gccgttgccatcgatgaccacgatatgcaaatctctcatgttatccgtggagatgaccat
attgctaatacaccaaaacagcttatggtctatgaatctcttggttgggaagctccagag
ttcggtcacatgaccttgattatcaactctgagactggtaagaagttatctaaacgtgat
actaatacacttcaatttatcgaagattaccgaaagaaaggttaccttccagaagcagtc
tttaactttattgctcttcttggttggaacccaggtggtgaagatgagattttctctcgt
gaagaactcattaaactttttgatgaaaaccgcctcagcaagtcaccagcagcctttgat
cagaaaaaactagactggatgagcaatgattatatcaagaatgcagaccttgaaaccatc
tttgaaatggcaaaaccattcttagaggaagcaggccgtttgactgacaaggctgaaaaa
ttagttgagctctataaaccacaaatgaaatcagtagatgagattatcccattgacagat
cttttcttctcagatttcccagaattgacagaagcagagcgcgaagtcatgacgggtgaa
acagttccaacagttcttgaagcattcaaagcaaaacttgaagcgatgacagatgataaa
tttgtgacagaaaatatcttcccacaaattaaagcagttcaaaaagaaacaggtattaaa
gggaaaaatcttttcatgcctattcgtatcgcagtttcaggcgaaatgcatgggccagaa
ttaccagatacaattttcttgcttggacgtgaaaaatcaattcagcatatcgaaaacatg
ctaaaagaaatctctaaataa

DBGET integrated database retrieval system