KEGG   Streptococcus pneumoniae gamPNI0373: HMPREF1038_02102Help
Entry
HMPREF1038_02102  CDS       T02334                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spng  Streptococcus pneumoniae gamPNI0373
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spng00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMPREF1038_02102
   00052 Galactose metabolism
    HMPREF1038_02102
   00500 Starch and sucrose metabolism
    HMPREF1038_02102
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF1038_02102
Enzymes [BR:spng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HMPREF1038_02102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1909910..1910809
Genome map
AA seq 299 aa AA seqDB search
MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGK
SKRSIEDHFDSNFELEYNLKEKGKIDLLKLVDKTTDMRLHFIRQTHPRGLGDAVLQAKAF
VGNEPFVVMLGDDLMDITDEKAVPLTKQLMDDYERTHASTIAVMPVPHDEVSAYGVIAPQ
GEGKDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFQILENQAPGAGNEIQLTDAID
TLNKTQRVFAREFNGARYDVGDKFGFMKTSIDYALKHPQVKDDLKNYLIQLGKELTEKE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaaagttagaaaggcagtcatccctgctgctggactaggaactcgattttta
ccagcaaccaaggcccttgccaaagaaatgttgccaatcgtagacaaaccaactatccag
tttatcgtggaagaagctctcaaatcaggtattgaagatattctagttgtcactggtaaa
tcaaaacgttctattgaggaccactttgattcaaacttcgaattggaatataacctcaaa
gaaaaagggaaaatagatcttttgaagctagttgataaaacaactgacatgcgtctgcat
tttatccgccaaactcatccacgcggtctcggagatgctgttttgcaagccaaggctttc
gtcggaaatgaaccttttgtcgttatgcttggtgatgacttgatggatatcacagacgaa
aaggctgttccacttaccaaacaactcatggatgactacgagcgtacccacgcgtctact
atcgctgtcatgccagtccctcatgacgaagtatctgcttacggggttattgctccgcaa
ggcgaaggaaaagatggtctttacagtgttgaaacctttgttgaaaaaccagctccagag
gacgctcctagcgaccttgctattatcggacgctacctcctcacgcctgaaattttccaa
atcctcgaaaaccaagctccaggtgcaggaaatgaaattcagctgacagatgcaatcgac
accctcaataaaacacaacgtgtatttgctcgtgagttcaatggggctcgttacgatgtc
ggagacaagtttggcttcatgaaaacatccatcgactacgccctcaaacacccacaagtc
aaagatgatttgaagaattacctcatccaacttggaaaagaattgactgagaaggaataa

DBGET integrated database retrieval system