KEGG   Streptococcus pneumoniae gamPNI0373: HMPREF1038_02193Help
Entry
HMPREF1038_02193  CDS       T02334                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
spng  Streptococcus pneumoniae gamPNI0373
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spng00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    HMPREF1038_02193
Enzymes [BR:spng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     HMPREF1038_02193
Exosome [BR:spng04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF1038_02193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2009294..2010802)
Genome map
AA seq 502 aa AA seqDB search
MSQEKYIMAIDQRTTSSRAIIFNKKGEKVSSSQKEFTQIFPQAGWVEHNANEIWNSVQSV
IAGAFIESGVKPNQIEAIGITNQRETTVVWDKKTGLPIYNAIVWQSRQTAPLAEQLKSQG
YVEKFHEKTGLIIDAYFSATKVRWILDHVEGAQERAEKGELLFGTIDTWLVWKLTDGAAH
VTDYSNAARTMLYNIKELKWDDEILEILNIPKAILPEVRSNSEIYGKTAPFHFYGGEVPI
SGMAGDQQAALFGQLAFDSGMVKNTYGTGSFIIMNTGEEMQLSENNLLTTIGYGINGKVY
YALEGSIFIAGSAIQWLRDGLRMVENSPESEKYARDSHNNDEVYVVPAFTGLGAPYWNQN
ARGSVFGLTRGTSKEDFIKATLQSIAYQVRDIIDTMQMDTQTAIQVLKVDGGAAMNNFLM
QFQADILGIDIARAKNLETTALGAAFLAGLSVGYWKDLDELKLLNETGELFEPSMNESRK
EQLYKGWKKAVKATQVFAEVDD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagaaaaatacatcatggccattgaccagagaactacaagttctcgtgccatc
attttcaacaaaaaaggggaaaaggttagctcgagtcaaaaagagtttacccagattttc
cctcaagcaggttgggttgagcacaatgccaatgaaatttggaactctgttcagtcagtt
attgcgggtgctttcatcgaaagtggtgtcaagccaaatcaaatcgaggcaatcgggatt
accaaccaacgtgaaacaacggttgtctgggataagaaaacaggacttcctatctacaat
gctatcgtttggcagtcacgccagacagcacctttggctgagcaactaaaaagccaaggt
tatgtggaaaaattccatgaaaagactggtttgattattgatgcttacttctctgctacc
aaggttcgttggattttggatcatgtagaaggtgctcaagagcgagcagaaaaaggggaa
ttgctctttggtactatcgatacttggttggtttggaaattgactgacggtgcggctcac
gtgactgactactcaaatgcagctcgtaccatgctttataacattaaagaactcaaatgg
gatgatgagattttggaaatccttaacattccgaaggctatacttccagaagttcgttct
aactccgaaatctacggcaagacagctccattccatttctacggtggagaggtgccaatc
tcaggtatggctggggaccaacaagcagccctctttggacagttggcttttgattcaggt
atggttaagaatacttatggaacaggctctttcatcatcatgaatactggggaagagatg
cagttgtctgaaaacaacctcttgacaaccattggttacggaatcaacggtaaggtttat
tatgccttggaaggttctatcttcatcgcaggaagtgctattcagtggcttcgtgacggt
cttcgcatggttgaaaattcaccagaatctgaaaaatacgctcgtgattctcacaacaac
gatgaagtttatgtcgttccagcctttacaggtctaggcgctccatactggaaccaaaat
gctcgtggttccgtctttggtttgactcgtggaacaagcaaagaagactttatcaaggcg
actttgcaatctattgcttatcaagtgcgtgacatcatcgacaccatgcaaatggatact
cagaccgccattcaagtactgaaggtggatggtggtgcagccatgaacaacttcctcatg
cagttccaggcggatattttaggcattgacattgcacgtgctaaaaacttggaaacaaca
gctctaggagcggccttcctagcaggtttgtcagtagggtactggaaagacttggacgag
ttgaaactcttgaacgagacaggagaactctttgagccatctatgaacgaatctcgcaag
gaacaactctacaagggctggaagaaggctgtgaaagcaactcaagtctttgcggaagta
gacgactaa

DBGET integrated database retrieval system