KEGG   Streptococcus pneumoniae SPN994038: SPN994038_16570Help
Entry
SPN994038_16570   CDS       T02630                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
spnm  Streptococcus pneumoniae SPN994038
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:spnm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1677952..1679394)
Genome map
AA seq 480 aa AA seqDB search
MPIQNKTMLITYSDSLGNNLKDLYDNLEEHFGDAIGGVHLLPFFPSTGDRGFAPVDYDEV
DSAFGDWEDVKRLGERYYLMFDFMINHISRQSKYYKDYQEKHEASEFKDLFLNWDKFWPE
NRPTQSDVDLIYKRKDRAPKQEIVFEDGSVEHLWNTFGEEQIDLDVTKEVTMEFIRKTIQ
HLASNGCDLIRLDAFAYAVKKLDTNDFFVEPDIWDLLDKVRDIAAEYGTELLPEIHEHYS
IQFKIADHDYYVYDFALPMVTLYTLYSSRTERLAKWLKMSPMKQFTTLDTHDGIGVVDVK
DILTDEEIDYASNELYKVGANVKRKYSSAEYNNLDIYQINSTYYSALGDDDVKYFLARLI
QAFAPGIPQVYYVGLLAGKNDLKLLEETKEGRNINRHYYSNEEIAKEVQRPVVKALLNLF
SFRNRSEAFDLEGTTEIETPTAHSIVIKRQNKDKSVTAVVEIDLQNQTYRVIENGVEVTF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccaattcaaaataaaaccatgttgattacctattctgatagccttggaaataatctt
aaagacttatatgataatttggaagagcattttggagatgctattggaggagttcacctt
ttaccatttttcccatcaacaggtgatcgtggatttgcgccagttgactacgacgaagtg
gactcagcttttggtgattgggaggatgttaagcgtttaggtgagagatattatcttatg
tttgattttatgattaatcatatttctcgtcaatccaagtattataaggactatcaagaa
aaacatgaagccagtgaatttaaagatctctttttaaactgggataagttttggccagaa
aaccgtccgacacagtctgatgtagatttaatttacaagcgtaaggatcgtgcaccaaag
caagagattgtgtttgaagatggttcagtggaacatttgtggaatacctttggtgaggag
cagattgatcttgatgtgaccaaagaagtaactatggaatttatccgtaagaccattcag
cacttggcaagtaatgggtgtgatttgattcgtctagatgcctttgcttatgcagtgaag
aaattggatactaatgatttctttgtggaaccagatatttgggatttattggacaaagtt
cgagatatcgctgctgagtatgggacagagcttttacctgagattcatgaacactattcg
attcagtttaaaatagcagaccatgattactatgtttatgattttgctcttccaatggtg
acactttatactctttacagttccagaacagagcgtttggctaagtggttaaagatgagc
ccgatgaagcaatttacgacgctagatacccatgatgggattggagtagtagatgtcaag
gatatcctgaccgatgaggagattgactatgcttcaaatgaactctataaggttggagcc
aatgtcaaacgtaagtactctagtgccgagtataacaacttagatatctaccaaatcaat
tcaacctactattcagcgcttggagatgatgatgtcaagtattttctcgctcgtctaatt
caagcttttgccccaggtattcctcaggtttactatgtgggtctattagcaggcaagaat
gacttgaaattattagaagaaactaaagaaggtcgaaatattaatcgtcattactatagc
aacgaagaaatagcaaaagaagtgcaacgacctgttgtgaaggcccttctcaatctattt
tctttccgtaaccgttcagaagcctttgatctagaagggactactgagatagagacacca
acagctcacagcattgtaatcaaacgtcaaaataaagataagtccgtaacagcagtagta
gaaattgatttgcaaaatcagacttatcgggtaattgagaatggagttgaagtaacattt
tga

DBGET integrated database retrieval system