KEGG   Streptococcus pneumoniae A026: T308_04120Help
Entry
T308_04120        CDS       T02890                                 

Definition
alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
spnn  Streptococcus pneumoniae A026
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spnn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    T308_04120
Enzymes [BR:spnn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     T308_04120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(797158..798612)
Genome map
AA seq 484 aa AA seqDB search
MQNQTLMQYFEWYLPHDGQHWTRLAENAPHLAHLGISHVWMPPAFKATNEKDVGYGVYDL
FDLGEFNQKGTVRTKYGFKEDYLQAIQALKAQGIQPMADVVLNHKAAADHREAFQVIEVD
PVDRTVELGEPFTINGWTSFTFDGRQDTYNGFHWHWYHFTGTDYDAKRSKSGIYLIQGDN
KGWANEELVDNENGNYDYLMYADLDFKHPEVIQNIYDWADWFMETTGVAGFRLDAVKHID
SFFMRNFIRDMKEKYGDDFYVFGEFWNPDKEANLDYLEKTEEHFDLVDVRLHQNLFEASQ
AGANYDLRGIFTDSLVELKPDKAVTFVDNHDTQRGQALESTVEEWFKPAAYALILLRQDG
LPCVFYGDYYGISGQYAQEDFKEILDRLLAIRKDLAYGEQNDYFDHANCIGWVRSGAENQ
SPIAVLISNDQENSKSMFVGQEWTNQTFVDLLGNHQGQVTIDEEGYGQFPVSARSVSVWA
VNTI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatcaaacactcatgcaatactttgaatggtatctgccccacgacggtcaacac
tggacgcgtctggctgaaaatgctccacacctagctcatctggggatcagtcacgtctgg
atgccaccagccttcaaggcaaccaacgaaaaagatgtcggctatggggtctatgactta
tttgacttaggagagttcaaccaaaaagggactgtccgcaccaagtatggtttcaaagaa
gactatcttcaagccattcaagcccttaaagcacagggaattcaacctatggccgatgta
gttctcaaccacaaggctgctgccgatcacagggaagcctttcaggtcatcgaagttgat
cctgtagaccgtacagttgaacttggagaacccttcaccatcaatggctggactagtttt
accttcgatggtcgccaagatacctataatggcttccactggcattggtaccacttcact
ggtacagactacgatgccaaacgcagtaaatctgggatttatctgatccaaggggacaac
aagggctgggctaacgaggaattggtcgataacgaaaacggaaactacgactacctcatg
tatgccgacctagactttaaacatcctgaagtcatccaaaacatctatgactgggctgat
tggttcatggaaacgactggtgtagctggtttccgtttggatgccgttaagcatattgac
tctttctttatgcgcaacttcatccgcgatatgaaggaaaaatacggtgacgatttctat
gtttttggtgaattttggaacccagacaaggaagccaatctggactatctcgaaaaaacg
gaagaacactttgaccttgtcgatgttcgtctccaccagaatctctttgaagccagtcaa
gctggcgcaaactatgaccttcgtggcattttcacagatagcctggttgaactcaagcct
gacaaggctgtgacttttgtcgacaaccacgatacccaacgaggacaagcccttgagtct
accgttgaagaatggttcaagccagcagcctatgccctcattttgttacgccaagacggc
cttccatgtgtcttttacggagactactatgggatttcaggccagtatgctcaagaagat
ttcaaagaaatccttgaccgcctcctagccatccgaaaagatttggcctatggagaacaa
aatgactactttgaccatgctaactgtatcggttgggtacgttcaggtgctgaaaatcaa
tccccaatcgcagtccttatctcaaatgaccaagaaaacagcaagtcaatgtttgtcggt
caagaatggactaatcaaacctttgtagatttacttggtaaccaccaaggtcaagttaca
attgatgaggaaggttatggacaattccctgtctcagctagatccgtaagtgtctgggca
gtcaataccatctaa

DBGET integrated database retrieval system