KEGG   Streptococcus pneumoniae A026: T308_07725Help
Entry
T308_07725        CDS       T02890                                 

Definition
sialidase
Orthology
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
spnn  Streptococcus pneumoniae A026
Pathway
Other glycan degradation
Sphingolipid metabolism
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:spnn00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:spnn00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1514392..1517334)
Genome map
AA seq 980 aa AA seqDB search
MSYFRNRDIDIERISMNRSVQERKCRYSIRKLSVGAVSMIVGAVVFGTSPVLAQEGASEQ
PLANETQLSGESSTLTDTEKSQPSSETELSGNKQEQERKDKQEEKIPRDYYARDLENVET
VIEKEDVETNASNGQRVDLSSELDKLKKLENATVHMEFKPDAKAPAFYNLFSVSSATKKD
EYFTMAVYNNTATLEGRGSDGKQFYGNYNDAPLKVKPGQWNSVTFTVEKPTPELPKGRVR
LYVNGVLSRTSLKSGNFIKDMPDVTHVQIGATKRANNTVWGSNLQIRNLTVYNRALTPEE
VQKRSQLFKRSDLEKKLPEGAVLTEKTDIFESGRNGKPNKDGIKSYRIPALLKTDKGTLI
AGADERRLHSSDWGDIGMVIRRSEDNGKTWGDRVTITNLRDNPKAFDPSIGSPVNIDMVL
VQDPETKRIFSIYDMFPEGKGIFGMSSQKEEAYKKIDGKTYQILYREGEKGAYTIRENGT
VYTPDGKATDYRVVVDPVKPAYSDKGDLYKGNQLLGNIYFTTNKTSPFRIAKDSYLWMSY
SDDDGKTWSAPQDITPMVKADWMKFLGVGPGTGIVLRNGPHKGRILIPVYTTNNVSHLNG
SQSSRVIYSDDHGKTWHAGEAVNDNRQVDGQKIHSSTMNNKRAQNTESTVVQLNNGDVKL
FMRGLTGDLQVATSKDGGVTWEKDIKRYPQVKDVYVQMSAIHTMHNGKEYIILSNAGGPN
RENGMVHLARVEENGELTWLKHNPIQKGEFAYNSLQELGNGEYGILYEHTEKGQNAYTLS
FRKFNWEFLSKDLISPTEAKVKRTREMGKGEMGKGVIGLEFDSEVLVNKAPTLQLANGKT
ATFLTQYDSKTLLFAVDKEDIGQEIIGIAKGSIESMHNLPVNLAGARVPGGVNGSKAAVH
EVPEFTGGVNGTEPAVHEIAEYKGSDSLVTLTTKEDYTYKAPLAQQALPETGNKESDLLA
SLGLTAFFLGLFTLGKKREQ
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatttcagaaatcgggatatagatatagagaggatcagtatgaatcggagtgtt
caagaacgtaagtgtcgttatagcattaggaaactatcggtaggagcggtttctatgatt
gtaggagcagtggtatttggaacgtctcctgttttagctcaagaaggggcaagtgagcaa
cctctggcaaatgaaactcaactttcgggggagagctcaaccctaactgatacagaaaag
agccagccttcttcagagactgaactttctggcaataagcaagaacaagaaaggaaagat
aagcaagaagaaaaaattccaagagattactatgcacgagatttggaaaatgtcgaaaca
gtgatagaaaaagaagatgttgaaaccaatgcttcaaatggtcagagagttgatttatca
agtgaactagataaactaaagaaacttgaaaacgcaacagttcacatggagtttaagcca
gatgccaaggctccagcattctataatctcttttctgtgtcaagtgctactaaaaaagat
gagtacttcactatggcagtttacaataatactgctactctagaggggcgtggttcggat
gggaaacagttttacggtaattacaacgatgcacccttaaaagttaaaccaggtcagtgg
aattctgtgactttcacagttgaaaaaccgacaccagaactacctaaaggccgagtgcgc
ctctacgtaaacggggtattatctcgaacaagtctgaaatctggcaatttcattaaagat
atgccagatgtaacgcatgtacaaatcggagcaaccaagcgtgccaacaatacggtttgg
gggtcaaatctacagattcggaatctcactgtgtataatcgtgctttaacaccagaagag
gtacaaaaacgtagtcaactttttaaacgctcagatttagaaaaaaaactacctgaagga
gcggttttaacagagaaaacggacatattcgaaagcgggcgtaacggtaaaccaaataaa
gatggaatcaagagttatcgtattccagcacttctcaagacagataaaggaactttgatc
gcaggtgcagatgaacgccgtctccattcgagtgactggggtgatatcggtatggtcatc
agacgtagtgaagataatggtaaaacttggggtgaccgagtaaccattaccaacttacgt
gacaatccaaaagcttttgacccatcgatcggttcaccagtgaatatcgatatggtgttg
gttcaagatcctgaaaccaaacgaatcttttctatctatgacatgttcccagaagggaag
ggaatctttggaatgtcttcacaaaaagaagaagcctacaaaaaaatcgatggaaaaacc
tatcaaatcctctatcgtgaaggagaaaagggagcttataccattcgagaaaatggtact
gtctatacaccagatggtaaggcgacagactatcgcgttgttgtagatcctgttaaacca
gcctatagcgacaagggtgatctatacaagggtaaccaattactaggcaatatctacttc
acaacaaacaaaacttctccatttagaattgccaaggatagctatctatggatgtcctac
agtgatgacgacgggaagacatggtcagcgcctcaagatattactccgatggtcaaagcc
gattggatgaaattcttgggtgtaggtcctggaacaggaattgtacttcggaatgggcct
cacaagggacggattttgataccggtttatacgactaataatgtatctcacttaaatggc
tcgcaatcttctcgtgtcatctattcagatgatcatggaaaaacttggcatgctggagaa
gcggtcaacgataaccgtcaggtagacggtcaaaagatccactcttctacgatgaacaat
aaacgtgcgcaaaatacagaatcaacggtggtacaactaaacaatggagatgttaaactc
tttatgcgtggtttgactggagatcttcaggttgctacaagtaaagacggaggagtgact
tgggagaaggatatcaaacgttatccacaggttaaagatgtctatgttcaaatgtctgct
atccatacgatgcataatggaaaagaatacattatcctcagcaatgcaggtggaccgaat
cgtgaaaatgggatggtccacttggcacgtgtcgaagaaaatggtgagttgacttggctc
aaacacaatccaattcaaaaaggagagtttgcctataattcgctccaagaattaggaaat
ggggagtatggcatcttgtatgaacatactgaaaaaggacaaaatgcctataccctatca
tttagaaaatttaattgggaatttttgagcaaagatctgatttctcctaccgaagcgaaa
gtgaagcgaactagagagatgggcaaaggagagatgggcaaaggagttattggcttggag
tttgactcagaagtattggtcaacaaggctccaacccttcaattggcaaatggtaaaaca
gcgactttcctaacccagtatgatagcaagaccttgttgtttgcagtagataaggaagat
atcggacaggaaattattggtatagctaaaggaagcatcgaaagtatgcataatcttcct
gtaaatctagcaggtgccagagttcctggcggagtaaatggtagcaaagcagcggtgcat
gaagttccagaatttacagggggagttaatggtacagagccagctgttcatgaaatcgca
gagtataagggatctgattcgcttgtaactcttactacaaaagaagattatacttacaaa
gctcctcttgctcagcaggcacttcctgaaacaggaaacaaggagagtgacctcctagct
tcactaggactaacagctttcttccttggtctgtttacgctagggaaaaagagagaacaa
taa

DBGET integrated database retrieval system