KEGG   Streptococcus pneumoniae A026: T308_09525Help
Entry
T308_09525        CDS       T02890                                 

Definition
penicillin-binding protein 2A
Orthology
K12555  
penicillin-binding protein 2A [EC:2.4.1.129 2.3.2.-]
Organism
spnn  Streptococcus pneumoniae A026
Pathway
beta-Lactam resistance
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:spnn00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    T308_09525
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    T308_09525
Enzymes [BR:spnn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     T308_09525
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     T308_09525
Glycosyltransferases [BR:spnn01003]
 Polysaccharide
  Bacterial polysaccharide
   T308_09525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1829147..1831342)
Genome map
AA seq 731 aa AA seqDB search
MKLDKLFEKFLSLFKKETSELEDSDSTILRRSRSDRKKLAQVGPIRKFWRRYHLTKIILI
LGLSAGLLVGIYLFAVAKSTNVNDLQNALKTRTLIFDREEKEAGALSGQKGTYVELTDIS
KNLQNAVIATEDRSFYKNDGINYGRFFLAIVTAGRSGGGSTITQQLAKNAYLSQDQTVER
KAKEFFLALELSKKYSKEQILTMYLNNAYFGNGVWGVEDASKKYFGVSASEVSLDQAATL
AGMLKGPELYNPLNSVEDSTNRRDTVLQNMVAAGYIDKNQETEAAEVDMTSQLHDKYEGK
ISDYRYPSYFDAVVNEAVSKYNLTEEEIVNNGYRIYTELDQNYQANMQIVYENISLFPRA
EDGTFAQSGSVALEPKTGGVRGVVGQVADNDKTGFRNFNYATQSKRSPGSTIKPLVVYTP
AVEAGWALNKQLDNHTMQYDSYKVDNYAGIKTSREVPMYQALAESLNLPAVATVNDLGVD
KAFEAGEKFGLNMEMVDRVLGVALGSGVETNPLQMAQAYAAFANEGLMPEAHFISRIENA
SGQVIASHKNSQKRVIDKSVADKMTSMMLGTFTNGTGISSSPADYIMAGKTGTTEAVFNP
EYTSDQWVIGYTPDVVISHWLGFPTTDENHYLAGSTSNGAAHVFRNIANTILPYTSGSTF
TVENAYKQNGIAPANTKRQVQTNDNSQTDDNLSDIRGRAQSLVDEASRAISDAKIKEKAQ
TIWDSIVNLFR
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagataaattatttgagaaatttctttctctttttaaaaaagaaacaagtgaa
ctagaggactctgattctactatcttacgtcgctctcgtagtgatcgaaaaaaattagcc
caagtaggtccgattcgaaaattctggcgtcgttatcatctaacaaagattatccttata
ctaggtttgagtgcaggattgctagttggaatctatttgtttgctgtagccaagtcgacc
aatgtcaatgatttgcaaaatgccttgaaaactcggactcttatttttgaccgtgaagaa
aaagaggctggtgccttgtctggtcaaaagggaacctatgttgagctgactgacatcagt
aaaaacttgcagaatgctgttattgcgacagaagaccgttctttctataaaaatgacggg
attaactatggccgtttcttcttggctattgtcactgctggacgttcaggtggtggctct
accattacccaacagctggctaaaaacgcctatttatcgcaggatcaaactgttgagaga
aaagcgaaagaatttttccttgccttagaattaagcaaaaaatatagtaaggagcaaatt
ctaaccatgtaccttaacaacgcttattttggaaatggtgtgtggggtgtagaagatgcg
agtaagaaatactttggagtttctgcatcagaagtgagtctggatcaagctgcgactctg
gcagggatgctcaaggggccggaactgtataatcccttgaattctgtagaagattctact
aatcggcgcgatactgtcttgcagaatatggttgcagcaggatatattgataaaaaccaa
gaaaccgaagctgctgaagttgatatgacttcgcaattgcacgataagtatgaaggaaaa
atctcagattaccgttacccctcttattttgatgcggtggttaatgaagctgtttccaag
tataatctaacagaggaagagattgtcaataatggctaccgcatttacacagagctggac
caaaactaccaagcaaatatgcagattgtttatgaaaacatatcgctatttccgagggca
gaggatggaacgtttgctcaatcaggaagtgtagctctcgaaccgaaaacagggggagtt
cgtggagttgtcggtcaagttgctgacaatgataaaactggattccggaatttcaactat
gcaacccaatcaaagcgtagtcctggttctacaattaagcctttagttgtttatacgcca
gcagttgaagcaggctgggctttgaataagcagttggataaccataccatgcagtatgac
agctataaggttgataactatgcagggatcaaaacgagtcgagaagttcctatgtatcaa
gccttggcagaatcgcttaatctacctgctgttgccactgttaatgatttgggtgtcgac
aaggcttttgaggcaggcgaaaaattcggactcaacatggaaatggttgaccgtgttctt
ggtgtcgccttgggaagcggtgttgaaaccaaccctcttcaaatggctcaagcatacgcc
gcctttgcaaatgaaggtttaatgcctgaagctcattttattagtagaattgaaaatgct
agtggacaagttattgcgagtcataaaaattcacaaaaacgggtgattgataagtctgta
gctgacaagatgaccagtatgatgttggggactttcaccaacggtaccggtattagttca
tcgcctgcagactatattatggcagggaaaactggaacaactgaagcagtttttaatccg
gagtacacaagtgaccagtgggtaattggttatactccggatgtagtgattagccactgg
cttggctttccgaccactgatgaaaaccactatctagctggctctacttcaaacggtgca
gctcatgtctttagaaacattgccaataccattttaccttatacgtcaggaagtaccttt
acggttgaaaatgcttataagcaaaatggaattgcaccagccaatacaaaaagacaagta
caaaccaatgataatagccagacagatgataatttgtctgatattcgagggcgtgcgcaa
agtctagtagatgaggctagccgggctatctcagatgcgaagattaaggaaaaggctcaa
acaatatgggattcgatagtcaatctatttcgctaa

DBGET integrated database retrieval system