KEGG   Streptococcus pneumoniae SPN994039: SPN994039_08240Help
Entry
SPN994039_08240   CDS       T02631                                 

Gene name
proB
Definition
putative glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
spno  Streptococcus pneumoniae SPN994039
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:spno01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:spno00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
840371..841480
Genome map
AA seq 369 aa AA seqDB search
MKYKRIVFKVGTSSLTNEDGSLSRSKVKDITQQLAMLHEAGHELILVSSGAIAAGFGALG
FKKRPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQILLTQDDFVDKRRYKNAHQAL
SVLLNRGAIPIINENDSVVIDEVKVGDNDTLSAQVAAMVQADLLVLLTDVDGLYTGNPNS
DPRAKRLERIETINREIIDMAGGAGSSNGTGGMLTKIKAATIATESGVPVYICSSLKSDS
MIEAAEETEDGSYFVAQEKGLRTQKQWLAFYAQSQGSIWVDKGAAEALSQHGKSLLLSGI
VEAEGVFSYGDIVTVFDKESGKSLGKGHVQFGASALEDMLRSQKAKGVLIYRDDWISITP
EIQLLFTEF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaacggattgtctttaaggtgggtacttcttctctgacaaatgaggatgga
agtttatcacgtagtaaggtaaaggatattacccagcagttggctatgctgcacgaggct
ggtcatgagttgattttggtgtcttcaggtgccattgcggctggttttggagccttagga
tttaaaaagcgtccgactaaaattgctgataaacaggcttcagcagcggtagggcagggg
cttttgttggaagaatatacaaccaatcttctcttgcgtcaaatcgtttctgcacaaatc
ttgctgacccaagatgactttgtggataagcgtcgttataaaaatgcccatcaggctttg
tcggttttgctcaaccgtggggcaattcctatcatcaatgagaatgatagtgtcgttatt
gatgaggtcaaggttggggacaatgacactctaagtgcccaagtagcggcgatggtccaa
gcagaccttttggttctcttgacagatgtggacggtctctatactggaaatcctaattca
gatccaagagccaaacgcttggagagaatcgagaccatcaatcgtgagattattgatatg
gctggtggagctggttcgtcaaacggaactgggggtatgttaaccaaaatcaaggctgca
actatcgcgacggaatcaggagttcctgtttatatctgctcatccttgaaatcagattcc
atgattgaggcggcagaggagaccgaggatggttcttactttgttgctcaagagaagggg
cttcgtacccagaaacaatggcttgccttctatgctcagagtcaaggttctatttgggtt
gataaaggggctgcggaagctctctctcaacatggaaagagtcttctcttatctggtatc
gttgaagcagaaggagtcttttcttacggtgatatcgtgacagtatttgacaaggaaagt
ggaaaatcacttggaaaaggacacgtgcaatttggagcatctgctttggaggatatgttg
cgttctcaaaaagccaagggtgtcttgatttaccgtgacgactggatttccattactcct
gaaatccaactactttttacagaattttag

DBGET integrated database retrieval system