KEGG   Streptococcus pneumoniae SPN994039: SPN994039_18990Help
Entry
SPN994039_18990   CDS       T02631                                 

Definition
Alpha galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
spno  Streptococcus pneumoniae SPN994039
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:spno00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SPN994039_18990
  Lipid metabolism
   00561 Glycerolipid metabolism
    SPN994039_18990
   00600 Sphingolipid metabolism
    SPN994039_18990
Enzymes [BR:spno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SPN994039_18990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1943287..1945503)
Genome map
AA seq 738 aa AA seqDB search
MTIYINKDETVFHLAMKDSSYIFRILENGELQHLHFGKRIHVKENYNQLMAYKKRGFEVS
FSEEFEDIQQSMIQNEYSSYGKGDFRHPAFQVQGMNGSRITTLKYQGFELEKGKNRLNSL
PSTFDDIGQCAETLTIILTDSILDLTVRLNYTIFPEYNVLVRNTEFLNNSNNKLTLLKAM
SLQLDLPDSQYDFIQFSGAWLRERQLYRTSLRPGIQAIDSLRYSSSPQQNPFFMLSRRET
TEHSGEVYGFNFIYSGNFQNMIEVDHFDTARVTVGINPVEFRFLLNPAESFVTPEAIVIY
SDQGMNQMSQQLSDFYRHHLVNPNFSQASRPIILNSWETFYFDLGTEKILDLAKAAKDLG
IELFVLDDGWFGHRKDDKSSLGDWVTDRSRLPEGIGFLADEIHKIGLQFGLWFEPEMISI
DSDLYKNHADWTIHLLDREKSVGRNQYVLDLTRQEVVDYLFDSISKIIIKTNLDYIKWDM
NRHITDIYSIELDSEQQMEFGHRYILGLYQLLDRLITKFPSVLFESCSSGGGRFDLGLMY
YAPQAWTSDDTDPIERLKIQHGTSYGYSPSMMTAHVSISPNEQSGRQTSLDTRTNVAYFS
SFGYELDVTRLSVEEKEQVREQIQFYKKYRSLFQYGDFYRINSPFSCDSASWQVVSKDKC
QSILLYAQLNSKLNPGYTRVYFSGLDKDKCYSVSRFDEFFYGDELMNAGIKVSLSNLALC
VPEYLTKLFVIEEVVCKY
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttatattaataaggacgagaccgtttttcatttggcaatgaaagatagtagt
tatatttttagaattttagaaaatggggaacttcaacatctacattttgggaaaaggatt
catgtcaaggaaaattataaccaattgatggcctataaaaaaagaggatttgaagtatct
ttttctgaagaatttgaggatattcaacagtctatgatacaaaatgaatattcttcatat
gggaaaggagattttcggcatccagcctttcaagttcaaggaatgaatggtagtaggata
acgacactaaaatatcaaggttttgaacttgaaaaagggaaaaatcgtcttaactctcta
ccttcaacatttgatgatattggtcagtgtgcggaaacattaacgattattttaacagat
tccatattagatttaactgttagactaaattacacaatttttccggaatacaatgtctta
gttagaaatacggaatttttaaataatagcaataataagttgactcttttgaaagcaatg
agcttacagctagatctacctgatagtcaatatgactttattcaattttctggagcatgg
ctgagggaacgtcagttatatagaacttcgcttagaccaggtattcaagcaatagatagc
ttgagatactcatcaagtcctcagcaaaatcctttctttatgctatcaaggagggaaact
acagagcatagtggtgaggtttatggttttaactttatctattctggaaattttcaaaat
atgattgaagttgaccattttgacaccgctagagtaacggtaggaataaatccagtagaa
tttcgttttttattaaatcctgccgaaagttttgtgacaccagaagcaattgtgatctat
tctgatcaagggatgaatcagatgagccaacaactatcagatttttatcgacatcattta
gttaatcctaatttttctcaagctagtcgtcctataatactcaatagttgggaaacattt
tattttgacttgggtacagaaaaaattttagatttagcaaaggctgctaaagatttagga
atagaattatttgtactggatgatggttggtttggtcataggaaagatgacaaaagttct
ctgggggattgggtaacagatagaagtcgccttcctgaaggtattggatttcttgcagat
gaaattcacaaaataggtttacaatttggtttgtggtttgagcctgaaatgatttctatt
gatagtgatttgtacaagaatcatgccgattggactatccatttgttagacagagagaag
tcagtaggaagaaatcaatatgtgttggatttgacgagacaggaagttgttgattacctt
tttgattctatttctaaaatcataatcaaaacaaatctggattatatcaaatgggatatg
aatcgtcatataacagatatttatagtattgaacttgattctgaacagcagatggaattt
ggtcatcgatatatcttaggtctttatcagttattagatcgtttaataactaagttccct
tcagttctatttgaatcttgttcttcaggtggtggacgttttgatttaggacttatgtat
tatgcaccgcaagcgtggacgagtgatgatacggacccgatagaaagattgaaaattcag
catggaacttcttatggatattctccatcaatgatgacagcccatgtttctatttctcca
aatgaacaaagtggaagacaaacgagtttggacactaggacaaatgtagcttattttagt
tctttcggttatgaattagatgttacgagattgtcggtagaagaaaaagaacaagtgaga
gaacaaattcagttttataaaaaatatcgttcattgtttcaatatggggatttctatagg
ataaacagtccttttagttgtgattctgctagttggcaagttgtttcaaaagataaatgc
caatcgattttattgtatgctcaattgaatagtaagttgaatccaggttatacaagagtt
tattttagtggtttagataaagataaatgctattccgtctctagatttgatgagttcttt
tatggagatgaattaatgaatgctggaataaaagtcagtttaagtaatttagcactttgt
gttccagaatatcttacaaaattatttgttattgaagaagttgtatgtaaatattga

DBGET integrated database retrieval system