KEGG   Streptococcus pneumoniae SPN034183: SPN034183_15000Help
Entry
SPN034183_15000   CDS       T02629                                 

Gene name
engA
Definition
(GenBank) GTP-binding protein EngA
  KO
K03977  GTPase
Organism
spnu  Streptococcus pneumoniae SPN034183
Brite
Ribosome biogenesis [BR:spnu03009]
 Prokaryotic Type
  GTPases
   SPN034183_15000 (engA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MMR_HSR1 KH_dom-like FeoB_N GTP_EFTU AIG1 Dynamin_N RsgA_GTPase Roc PduV-EutP ABC_tran SRPRB Ras RNA_helicase Nuc_deoxyrib_tr AAA_18 AAA Gtr1_RagA cobW Nuc_deoxyri_tr2 NTPase_1 DUF1194
Motif
Other DBs
NCBI-ProteinID: CCP33210
Position
complement(1529702..1531012)
Genome map
AA seq 436 aa AA seqDB search
MALPTIAIVGRPNVGKSTLFNRIAGERISIVEDVEGVTRDRIYATGEWLNRSFSMIDTGG
IDDVDAPFMEQIKHQAEIAMEEADVIVFVVSGKEGITDADEYVARKLYKTHKPVILAVNK
VDNPEMRNDIYDFYALGLGEPLPISSVHGIGTGDVLDAIVENLPNEYEEENPDVIKFSLI
GRPNVGKSSLINAILGEDRVIASPVAGTTRDAIDTHFTDTDGQEFTMIDTAGMRKSGKVY
ENTEKYSVMRAMRAIDRSDVVLMVINAEEGIREYDKRIAGFAHEAGKGMIIVVNKWDTLE
KDNHTMKNWEEDIREQFQYLPYAPIIFVSALTKQRLHKLPEMIKQISESQNTRIPSAVLN
DVIMDAIAINPTPTDKGKRLKIFYATQVATKPPTFVIFVNEEELMHFSYLRFLENQIRKA
FVFEGTPIHLIARKRR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggccctaccaactattgccattgtaggacgtcccaatgttgggaaatcaaccctattt
aatcggatcgctggtgagcgaatctccattgtagaagatgtcgaaggagtgacacgtgac
cgtatttatgcaacgggtgagtggctcaatcgttcttttagcatgattgatacaggagga
attgatgatgtcgatgctcctttcatggaacaaatcaagcaccaggcagaaattgccatg
gaagaagcagatgttatcgtttttgtcgtgtctggtaaggaaggaattactgatgcagac
gaatacgtagctcgtaagctttataagacccacaaaccagttatcctcgcagtcaacaag
gtggacaaccctgagatgcgaaatgatatctatgatttctatgccctcggtttgggtgaa
ccactgcctatctcatctgtccatggtatcggtacaggggatgtactagatgcgattgtg
gaaaaccttccaaatgaatatgaagaagaaaatccagatgtcattaagtttagcttgatt
ggtcgtcctaacgttggaaaatcaagcttgattaatgctatcttgggagaagaccgtgtc
attgccagtcctgttgctggaacaactcgtgacgctattgatacccactttacagataca
gatggtcaagagtttaccatgattgatacggctggtatgcgtaagtctggtaaggtttat
gaaaatactgagaagtactctgtcatgcgtgccatgcgtgctattgaccgttcagatgtg
gtcttaatggtcatcaatgcggaagaggggattcgtgaatacgacaaacgtatcgctgga
tttgctcatgaagctggtaaagggatgattatcgtggtcaacaagtgggatacgcttgaa
aaagataaccacactatgaaaaactgggaagaagatatccgtgagcagttccaatacctg
ccttacgcaccgattatctttgtatcagctttaaccaagcaacgtctccacaaacttcct
gagatgattaagcaaatcagcgaaagtcaaaatacacgtattccatcagctgtcttgaac
gatgtcatcatggatgccattgccatcaacccaacaccgacagacaaaggaaaacgtctc
aagattttctatgcgacccaagtggcaaccaaaccaccaacctttgtcatctttgtcaat
gaagaagaactcatgcacttttcttacctgcgtttcttggaaaatcaaatccgcaaggcc
tttgtttttgagggaacaccgattcatctcatcgcaagaaaacgcagataa

DBGET integrated database retrieval system