KEGG   Streptococcus pneumoniae SPN034183: SPN034183_15150Help
Entry
SPN034183_15150   CDS       T02629                                 

Gene name
mvaA
Definition
(GenBank) 3-hydroxy-3-methylglutaryl-coenzyme A reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
spnu  Streptococcus pneumoniae SPN034183
Pathway
spnu00900  Terpenoid backbone biosynthesis
spnu01110  Biosynthesis of secondary metabolites
spnu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:spnu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPN034183_15150 (mvaA)
Enzymes [BR:spnu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     SPN034183_15150 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: CCP33225
Structure
PDB: 

Jmol
Position
complement(1546743..1548017)
Genome map
AA seq 424 aa AA seqDB search
MKISWNGFSKKSYQERLELLKAQALLSPERQASLEKDEQMSVTVADQLSENVVGTFSLPY
SLVPEVLVNGQEYTVPYVTEEPSVVAAASYASKIIKRAGGFTAQVHQRQMIGQVALYQVA
NPKLAQEKIASKKAELLELANQAYPSIVKRGGGARDLHVEQIKGEPDFLVVYIHVDTQEA
MGANMLNTMLEALKPVLEELSQGQSLMGILSNYATDSLVTASCRIAFRYLSRQKDQGREI
AEKIALASQFAQADPYRAATHNKGIFNGIDAILIATGNDWRAIEAGAHAFASRDGRYQGL
SCWTLDLEREELVGEMTLPMPVATKGGSIGLNPRVALSHDLLGNPSARELAQIIVSIGLA
QNFAALKALVSTGIQQGHMKLQAKSLALLAGASESEVAPLVERLISDKTFNLETAQRYLE
NLRS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaagataagttggaatggattttctaaaaaatcataccaagagcgcctcgagctgtta
aaagctcaggcgctccttagtcctgagagacaagctagtctggagaaggatgaacagatg
agcgtgactgtggcagaccagctgagtgagaatgtagtgggaactttttctctgccttat
tcactggttccagaggtacttgtcaacggtcaggaatacaccgttccctatgtgacagaa
gaaccctctgtggttgcggcggccagctatgccagcaaaatcatcaagcgtgcaggtggt
tttactgcacaagtccatcagcgacagatgattgggcaggtagccctttatcaagttgct
aatcctaaactagcgcaagagaagattgccagcaagaaagcggagctcttggagcttgcc
aatcaagcctatccttctatcgttaaacgtggaggtggggcgcgtgatctgcatgtcgag
cagataaaaggcgaaccagactttctcgttgtttatattcatgtcgatacccaggaagcc
atgggtgccaatatgctcaacaccatgctggaagccttgaaaccagtcttagaagaactc
agtcagggacagagtctcatgggaatcctgtccaactacgcgaccgattctctggtgact
gcaagctgtcgcatcgcctttcgctacttgagccgccaaaaggatcaaggacgagagatt
gcggagaaaattgcgttggctagtcagtttgcgcaggctgatccttaccgagctgctact
cataataaaggaatttttaatggtattgatgcgattttgattgccactggtaatgactgg
cgtgccatcgaagctggggcccatgcctttgccagtcgagatggacgctatcaaggtctt
agctgctggacgctggaccttgaaagagaagaattggtcggtgagatgaccctgcccatg
cctgtagcgactaagggtggctctatcggcctcaacccacgtgtagctctcagtcatgat
ctactaggaaatccttctgccagagaattagcccagattatcgtgtccatcggtcttgct
caaaattttgcagccctcaaagccttggtaagtacgggcatccagcaaggccacatgaaa
ctacaggccaaatccctagctctcctagctggggctagtgaatctgaagttgctccccta
gtagagcgcctcatctcagataaaacctttaacctagagacagcccagcgctatctcgaa
aatttaagatcataa

DBGET integrated database retrieval system