KEGG   Streptococcus pneumoniae SPN034183: SPN034183_15350Help
Entry
SPN034183_15350   CDS       T02629                                 

Definition
(GenBank) putative nicotinate-nucleotide adenylyltransferase
  KO
K00969  nicotinate-nucleotide adenylyltransferase [EC:2.7.7.18]
Organism
spnu  Streptococcus pneumoniae SPN034183
Pathway
spnu00760  Nicotinate and nicotinamide metabolism
spnu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spnu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SPN034183_15350
Enzymes [BR:spnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     SPN034183_15350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like ATP-sulfurylase
Motif
Other DBs
NCBI-ProteinID: CCP33245
Position
complement(1565966..1566595)
Genome map
AA seq 209 aa AA seqDB search
MTIELLTPFTKVELEPEIKEKKRKQVGILGGNFNPVHNAHLIVADQVRQQLGLDQVLLMP
EYQPPHVDKKETIPEHHRLKMLELAIEGIDGLVIETIELERKGISYTYDTMKILTEKNPD
TDYYFIIGADMVDYLPKWYRIDELVDMVQFVGVQRPRYKVGPSYPVIWVDVPLMDISSSM
VRDFIAQGRKPNFLLPQPVLDYIEKEGLY
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgaactattgactccctttaccaaggtagagttggagccagaaatcaaggag
aaaaaacgcaaacaagttgggattttaggggggaattttaaccctgttcacaatgcccat
ctcattgttgcggatcaagtacggcaacagttgggactggatcaagttctgctcatgcct
gaataccaacctcctcacgttgataaaaaggaaaccatccctgaacaccatcgtctcaag
atgcttgagttggcaattgagggaattgacggcctagtcattgaaaccattgagttggag
cgcaagggtatttcctacacctacgacaccatgaagattttgacagagaagaatccagat
acggattactactttatcatcggtgccgacatggttgactatctgcctaagtggtaccga
attgatgaactggttgacatggttcagtttgtgggggttcagcgtccacgctacaaggta
gggccttcctatccagttatctgggtggacgtaccgctcatggatatctcgtccagcatg
gtgcgggacttcattgcccaaggtcggaaacccaactttctcttacctcagccagtgcta
gactacatcgagaaggaggggctctactga

DBGET integrated database retrieval system