KEGG   Streptococcus pneumoniae SPN034183: SPN034183_15580Help
Entry
SPN034183_15580   CDS       T02629                                 

Definition
(GenBank) hypothetical protein
Organism
spnu  Streptococcus pneumoniae SPN034183
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CCP33268
Position
complement(1583762..1584001)
Genome map
AA seq 79 aa AA seqDB search
MKREVISNGNDGPSQEILIFTKQIRHWILSDQVISGKRKLFFREDTPKEILDLYENIKSK
LDFAYQEVYSNNGLKKYEK
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagaggtgataagcaatggaaatgatggaccaagtcaggaaattttgattttt
acaaaacaaattcgtcattggattcttagtgatcaagttatttcagggaaaagaaaactt
ttcttccgggaagatactccaaaagagattttagatttgtacgaaaacattaaatctaaa
cttgattttgcttaccaagaagtttattctaataatgggttgaaaaaatatgaaaaatag

DBGET integrated database retrieval system