KEGG   Streptococcus pneumoniae SPN034183: SPN034183_15790Help
Entry
SPN034183_15790   CDS       T02629                                 

Definition
(GenBank) putative membrane protein
Organism
spnu  Streptococcus pneumoniae SPN034183
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2273 ECF-ribofla_trS YqzM DUF4535 UPF0370 Phage_holin_5_2 RseC_MucC
Motif
Other DBs
NCBI-ProteinID: CCP33289
Position
1601559..1601729
Genome map
AA seq 56 aa AA seqDB search
MEWLKQYRYPIIAGLIGVFLACLIVSFGFFKTIFVLILGALGVAAGLYIEKNYIDK
NT seq 171 nt NT seq  +upstreamnt  +downstreamnt
atggaatggcttaaacaatatcgatatccaattatcgctggtctcataggcgtatttctg
gcttgtttgattgtctcctttggcttcttcaaaacaatatttgtattgattttaggagca
ctgggagttgcagctggattatatatcgaaaaaaactatatagataaataa

DBGET integrated database retrieval system