KEGG   Streptococcus pneumoniae SPN034183: SPN034183_15930Help
Entry
SPN034183_15930   CDS       T02629                                 

Definition
(GenBank) type IV prepilin peptidase family protein
  KO
K02236  leader peptidase (prepilin peptidase) / N-methyltransferase [EC:3.4.23.43 2.1.1.-]
Organism
spnu  Streptococcus pneumoniae SPN034183
Module
spnu_M00429  Competence-related DNA transformation transporter
Brite
Enzymes [BR:spnu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     SPN034183_15930
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.43  prepilin peptidase
     SPN034183_15930
Secretion system [BR:spnu02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   SPN034183_15930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DiS_P_DiS
Motif
Other DBs
NCBI-ProteinID: CCP33303
Position
1613583..1614242
Genome map
AA seq 219 aa AA seqDB search
MIDFYFFLVGSILASFLGLVIDRFPEQSIISSASHCDSCQTRLRPLDLIPILSQVFNRFR
CRYCKVRYPVWYALFELVLGLLFLLYSWKLLSLGQVVLITAGLTLGIYDFHHQEYPLLVW
MTFHLILITSSGWNLVMVSFLILGILAHFIDIRMGAGDFLFLASCALVFSVTELLILIQF
ASATGILAFILQKKKERLPFVPFLLLATCLIIFGKLLLV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttttatttttttctcgtcgggagcattctcgcttcctttcttggtttggtc
attgaccgttttccagagcaatccattatcagttcagccagtcactgcgattcctgtcag
actcgcttgcgtcccttagatttgattccgattctctcacaggtcttcaatcgctttcgc
tgtcgctactgcaaagttcgctatcctgtctggtatgccctctttgaattagtcttagga
ctcctctttctgctttactcttggaaattgctttccttggggcaagtcgtcctaatcacc
gctggtttgaccttgggtatctacgactttcaccatcaggaatatcccttactggtctgg
atgactttccacctaatcctaataacttcctctggctggaatctggtcatggtctccttc
ctcatacttggaattttggctcattttatcgatatccgcatgggcgcaggggatttcctc
tttttagcttcttgtgctctcgtctttagcgtaacggagttactgatcttgattcagttt
gcttctgcgacgggtatcctggcctttatcctgcaaaagaaaaaggaaagacttcctttc
gtgcctttcctcttacttgctacttgtttgattatttttggtaagctactgcttgtctga

DBGET integrated database retrieval system