KEGG   Streptococcus pneumoniae SPN034183: SPN034183_15980Help
Entry
SPN034183_15980   CDS       T02629                                 

Gene name
trpF
Definition
(GenBank) N-(5'-phosphoribosyl)anthranilate isomerase
  KO
K01817  phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
spnu  Streptococcus pneumoniae SPN034183
Pathway
spnu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spnu01100  Metabolic pathways
spnu01110  Biosynthesis of secondary metabolites
spnu01130  Biosynthesis of antibiotics
spnu01230  Biosynthesis of amino acids
Module
spnu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spnu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPN034183_15980 (trpF)
Enzymes [BR:spnu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     SPN034183_15980 (trpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRAI
Motif
Other DBs
NCBI-ProteinID: CCP33308
Position
complement(1618463..1619062)
Genome map
AA seq 199 aa AA seqDB search
MTKVKICGLSTKEAVETAVSAGADYIGFVFAPSKRQVTLEEAAELAKLIPADVKKVGVFV
SPSRVELLEAIDKVGLDLVQVHGQVADDLFENLPCASIQAVQVDGNGHVPNSQADYLLFD
APVAGSGQSFDWGQLDTTGLAQPFFIAGGLNEDNVVKAIQHFTPYAVDVSSGVETDGQKD
HEKIRRFIERVKHGISGTK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgacaaaggttaaaatttgtggactatcgaccaaagaagcggtggaaacagccgtttca
gcaggagccgactatatcggttttgtctttgcacctagtaaaagacaggtgactttagaa
gaggcagctgagttggcaaagcttattcctgcagatgtgaaaaaggttggagtatttgtt
tcaccaagtcgggtagaactgctggaagcgattgacaaagttggcttggacttggttcaa
gttcacggtcaggtggcagatgatttatttgagaatttgccttgtgccagtattcaggct
gtgcaggtagatggaaatgggcatgtccccaattctcaggcagattatctactctttgat
gcccctgtggcaggaagtggccagtcctttgattggggtcaactggatacgactggacta
gcacagcccttctttatcgcaggtggccttaatgaagataatgtagtaaaagcaattcaa
cattttactccctatgcagtagatgtatcgagcggagtggagacagatggacaaaaagat
catgaaaagattagaagatttatagagagggtaaagcatggcatatcaggaaccaaataa

DBGET integrated database retrieval system