KEGG   Streptococcus pneumoniae SPN034183: SPN034183_16150Help
Entry
SPN034183_16150   CDS       T02629                                 

Definition
(GenBank) ABC transporter, ATP-binding/permease protein
  KO
K18890  ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
spnu  Streptococcus pneumoniae SPN034183
Pathway
spnu02010  ABC transporters
Module
spnu_M00707  Multidrug resistance, MdlAB/SmdAB transporter
Brite
KEGG Orthology (KO) [BR:spnu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SPN034183_16150
Transporters [BR:spnu02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    SPN034183_16150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran RsgA_GTPase AAA_15 AAA_16 SMC_N AAA_23 MMR_HSR1 AAA_10 AAA_29 AAA_22 Dynamin_N AAA AAA_21 AIG1
Motif
Other DBs
NCBI-ProteinID: CCP33325
Position
complement(1637233..1638984)
Genome map
AA seq 583 aa AA seqDB search
MQNKQEQWAVLKRLMSYLKPYGLLTFLALSFLLATTVIKSVIPLVASHFIDQYLSNLNQL
AVTVLLVYYGLYILQTVVQYVGNLLFARVSYSIVRDIRRDAFVNMEKLGMSYFDKTPAGS
IVSRLTNDTETISDMFSGILSSFISAVFIFLTTLYTMLVLDFRLTALVLLFLPLIFLLVN
LYRKKSVKIIEKTRSLLSDINSKLAENIEGIRIIQAFNQEKRLQAEFDEINQEHLVYANR
SVALDALFLRPAMSLLKLLGYAVLMAYFGYRGFSIGITVGTMYAFIQYINRLFDPLIEVT
QNFSTLQTAMVSAGRVFALIDERTYEPLQENGQAKVQEGNIHFEHVCFSYDGKHPILDDI
SFSVNKGETIAFVGHTGSGKSSIINVLMRFYEFQSGRVLLDDVDIRDFSQEELRKNIGLV
LQEPFLYHGTIKSNIAMYQEISDEQVQAAAAFVDADSFIQELPQGYDSPVSERGSSFSTG
QRQLLAFARTVASQPKILILDEATANIDSETESLVQASLAKMRQGRTTIAIAHRLSTIQD
ANCIYVLDKGRIIESGTHEELLALGGTYHKMYSLQAGAMADTL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgcagaataaacaagaacaatgggctgtattgaagcgcttgatgtcttatctcaagcct
tatggactcctgacctttttggcactcagttttctcctagcgacgacggtcattaaaagt
gtcatacccctcgtggcttcccactttatcgaccagtatctcagcaatcttaaccaacta
gccgttaccgttttgctggtctactatggtctctacatcctacaaactgtagttcagtat
gtcggcaatcttctctttgcgcgcgtgtcttacagtattgttagggatattcgtcgagat
gcctttgtcaatatggagaaactgggcatgtcttactttgacaagacgccagcaggttct
atcgtttctcgtttgaccaacgataccgagacgattagtgatatgttttctgggatttta
tccagctttatctcagcagtttttatctttctgacaaccctttataccatgttggtgctg
gattttcgtttgacggctttagtcttgctctttcttcctttgattttccttttggtcaat
ctctatcgaaaaaagtcagtgaaaatcatcgagaaaaccagaagtctcttgtcagatatc
aatagtaagctggcagagaatatcgagggaatcaggattattcaggcctttaatcaagag
aagcgcctgcaggcagaatttgatgaaatcaaccaagaacacttggtctacgccaaccgt
tctgtagccttggatgccctctttttgagacctgccatgagtttgctgaaacttctaggc
tatgcagtcttgatggcctactttggctaccgtggtttttctatcgggataacggtcggg
accatgtatgcctttatccagtacatcaaccgcctttttgaccccttgattgaggtgacg
caaaacttttcaactctgcaaacggctatggtttctgcaggtcgtgtctttgccctgata
gacgagaggacctatgagccccttcaagaaaatgggcaggctaaagtccaagaaggcaat
atccattttgaacatgtgtgtttctcatatgacggtaaacatccgattctggatgacatt
tctttctctgttaataagggtgaaaccattgcctttgtaggtcatacaggttcagggaaa
tcgtctattatcaatgtcctcatgcgcttttatgaattccagtcagggagagttctcttg
gatgatgtggatatcagggatttcagtcaagaagagctgagaaaaaacatcggtttggtc
ttgcaggaacccttcctctatcatggaactattaagtccaatatcgccatgtaccaagaa
atcagtgatgagcaggttcaggctgcggcagcctttgtggatgcagattcctttattcaa
gaacttcctcaggggtacgactcccctgtttccgagcgtggttcgagcttctctactggg
cagcgccagcttcttgcctttgctagaacagtcgccagccagcctaaaatcctgattttg
gatgaagcgacagccaatattgactctgaaacagaaagtttggttcaagcttctctggcg
aagatgagacagggccgaacaactattgctatcgctcaccgcctttctactattcaagac
gccaactgcatctatgtcttggataagggacgcattatcgagagtggaacccatgaggaa
ctcttggctctgggaggaacttatcacaagatgtatagtttgcaggcaggggccatggcc
gatactctttga

DBGET integrated database retrieval system