KEGG   Streptococcus pneumoniae SPN034183: SPN034183_16720Help
Entry
SPN034183_16720   CDS       T02629                                 

Gene name
aga
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
spnu  Streptococcus pneumoniae SPN034183
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:spnu00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:spnu00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:spnu00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1693163..1695325)
Genome map
AA seq 720 aa AA seqDB search
MGVRIENNLFYVESKNLSLIIENRNGYLLLKHLGKTIKNYKGSNSVYERDHAFSGNPTAT
NRTFSLDTQRQIFGQHGLGDFRKPTIQVQHSVTEVTDFRFVEAKILKGQNGPQGLPSPHS
MDDTETLVLMLEDSKAQLSLTLYYTTFNNDATIASYSKLDNNSNQEVVIHKDFSFMADFP
AADYEIVTLQGAYAREKTVRRQQVEQGIFSISSNRGASGHTQTPALLLCEQGVTEDAGNV
FAIQLMYSGNFEAFVQKNQLNEVRVAIGINPENFSWKLAPEEYFETPVALVTHSDQGLTG
ISHESQNFVLKHIMLSEFSKKERPILINNWEATYFDFQREKLLELADEAKKVGIELFVLD
DGWFGNRFDDNRALGDWVVNEEKLGGSLESLISAIHERGLQFGLWLEPEMISVDSDLYRR
HPDWAIQVPDYEHTYSRNQLVLNLANPQVVEYLKSVLDQLLSYHDIDYIKWDMNRNITKL
GNGLTYLETQMQSHQYMLGLYELVSYLTEKHSHILFESCSGGGGRNDLGMIRYFPQVWAS
DNTDAIARLPIQYGSSYLYPTISMGAHVSAVPNHQMGRMTPLETRGHVAMMGNLGYELDL
TNLSDEEKATIANQVNLYKELRPVVQLGQQYRLINPDTASNEAAVQFNYGNQTIVTYVRV
LSVVETMETTLKLKDLDEEGLYELQENGEVYSGAELMYAGLTVILSQGDFLSRQYIFRRL
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgggagttaggatagagaataatctattttatgttgagagtaaaaatctaagtttgatt
attgaaaatcgaaatggctacttacttttgaaacatttaggaaagactattaagaactat
aaaggttccaatagtgtttatgaacgagaccatgccttttcaggaaatccaacggctact
aatcgaacctttagtttagatactcagcgacagatttttggacaacatggcttaggagat
tttaggaaaccaaccatacaggttcagcatagtgtaactgaagtaacagactttcgattt
gtagaagcaaagattttaaaaggtcagaatggtccacagggcttaccttctccacatagc
atggacgatacagagactcttgtcttaatgttagaagattctaaggctcaacttagtctg
actttgtattatactacttttaataatgatgcgactattgctagctacagtaaattagat
aataatagtaatcaggaagttgtcatccataaagatttttcttttatggctgattttcca
gctgcagattacgaaatagtaactctgcagggtgcttatgctcgtgaaaagactgttaga
cgtcaacaggtagaacaaggaatcttttcgattagctcaaaccgaggtgcttctggtcat
actcaaacaccagctcttctactatgcgaacaaggagtcacagaggatgctgggaatgtg
tttgctattcaactaatgtatagtggcaactttgaagcttttgttcaaaaaaatcaattg
aatgaagttcgggtggctattggcattaatccagaaaacttttcttggaagttagctcct
gaggaatactttgaaacaccagtagctttagtgacccattcagatcagggattaactggt
attagtcatgaaagtcagaattttgtactgaagcacattatgctaagtgaattttctaaa
aaagaacgtccaattctaatcaataactgggaagctacttactttgactttcagagagaa
aaactgttagagttagcagatgaagctaagaaagttggcattgaactttttgtattagat
gatggttggtttggcaatcgttttgatgataatcgtgctttaggtgattgggttgttaat
gaggaaaaactgggtggaagtctagaaagtctgatttcagctatccatgaaagaggtttg
cagtttggactttggttagaacccgaaatgatttctgtagatagtgatttgtatcgtcga
catcctgactgggctattcaggttcctgactatgagcatacttattctcggaatcaatta
gtacttaatcttgccaatcctcaggtagtagaatacttgaaaagtgtcttagatcaactc
ctatcttatcatgatattgattacattaaatgggatatgaaccgcaatatcactaagcta
gggaatggattaacttatctagagacacagatgcaatctcatcagtacatgctggggctt
tacgaactcgtttcttatctgacagagaagcacagccatattctctttgagtcctgctct
ggtggtggtggacgaaatgatcttggtatgatacgctatttcccacaagtctgggctagt
gataatactgatgccattgcacgtttaccaattcaatacggttcatcctatctctatcca
accatttctatgggggctcatgtgtcagcagtaccgaatcatcagatgggacgaatgaca
ccattagaaacacgtggccatgtagcaatgatgggaaatttgggctatgagcttgatttg
acaaatttatcagatgaagagaaagctacgattgctaatcaggtgaacttgtataaagaa
ttacgaccagtagttcagttaggacagcagtatagactaattaatcctgatactgcatcc
aatgaagcagctgtacaatttaattacggaaatcaaacgattgtaacctacgttcgcgtt
ttatctgttgtagagaccatggaaacaactttaaaattaaaagatttggatgaagaggga
ctatatgaattacaggaaaatggcgaagtttactcaggtgcagaactaatgtatgcgggc
ctaactgttatcttatcccaaggagattttttgagtagacagtatatttttagaagacta
tga

DBGET integrated database retrieval system