KEGG   Streptococcus pneumoniae SPN034183: SPN034183_19070Help
Entry
SPN034183_19070   CDS       T02629                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
spnu  Streptococcus pneumoniae SPN034183
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:spnu00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1949836..1950564)
Genome map
AA seq 242 aa AA seqDB search
MSQDEKLIREQICDVCHKMWQLGWVAANDGNVSVRLDEDTILATPTGISKSFITPEKLVK
LNLKGEILEAEGDYCPSSEIKMHIRCYEEREDVRSVVHAHPPIATGFALAHIPLDTYSLI
ESAIVVGAIPITPFGVPSTMEVPEAITPYLPDHDVMLLENHGALTVGSDVITAYYRMETL
ELVAKTTFHGRMLLSTKGIEEQEIARPTLERLFSMRENYKVTGRHPGYRKYNGDGSMKET
EK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagatgaaaaattaattcgtgaacagatttgtgatgtttgtcataagatgtgg
caacttggttgggttgctgctaacgatgggaatgtatctgttcgattagatgaggatacc
attcttgcaacacctactggtatcagcaaaagttttattacaccagaaaagctggtgaag
ttaaatcttaaaggagagattttagaagcagaaggtgattactgtccttctagtgaaatt
aaaatgcacattcggtgctacgaagaacgtgaggatgtccgttcagttgttcacgcgcat
ccaccgattgcaacaggatttgctcttgcacacattcctttagatacttattcactaatt
gagagcgcgattgtggtaggagcaattcctataacgccatttggagttccgtctacaatg
gaagtgccagaagcaattacaccttatctgcccgatcatgatgtcatgctattagaaaat
catggagctctgactgtcggaagcgatgtaattacagcatactaccgtatggaaacttta
gaattagtcgcaaagacaaccttccacggaagaatgttactttctacaaagggcattgag
gagcaagaaattgctcgtccgactttagaacgtctattctcaatgcgagaaaattataag
gttacaggtcgtcacccaggctaccgtaaatataatggcgatggtagtatgaaagaaaca
gaaaaataa

DBGET integrated database retrieval system