KEGG   Schizosaccharomyces pombe (fission yeast): SPAC10F6.05cHelp
Entry
SPAC10F6.05c      CDS       T00076                                 

Gene name
ubc6
Definition
ubiquitin conjugating enzyme Ubc6 (predicted) (EC:6.3.2.19)
Orthology
K04554  
ubiquitin-conjugating enzyme E2 J2 [EC:6.3.2.19]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:spo04141]
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:spo04120]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(join(1215121..1215638,1215723..1215861,1215902..1215928))
Genome map
AA seq 227 aa AA seqDB search
MASKGAYKRLMKEYLALQKNPVELVDAKPATENILEWHYIITGPPDTPYEGGQYHGTLIF
PPDYPFKPPAIRMITPSGRFQTNTRLCLSFSDFHPKSWNPSWMVSTILVGLVSFMTSDEI
TTGGIVTSESTRRTYAKDTKRFNIMDNPKFLIMFPELIDKNREDIAKAAAEAALIEPQQI
HSTPVSSNECKKNEPFNSKQSWVKSRWSIAVLVFFALALARFFGADS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaaaggtgcttataaacggttaatgaaagaatatctagctcttcagaaaaac
cctgttgagcttgttgacgctaaacctgcaactgaaaacattttggaatggcattatatt
atcactggccctccggacactccatatgaaggaggacaatatcatgggacattgattttt
cctcccgattatccttttaagccacctgcaattcgcatgattactccaagcggacgtttc
caaacgaataccagactttgtctttctttttctgacttccatccaaaatcctggaatccc
tcatggatggtttctactattctggtgggactcgtttctttcatgacttctgatgagatt
accactggaggtattgtaacttcggagtctaccaggagaacttacgcaaaggatacgaag
agatttaacattatggataatcctaaattcttaataatgttccccgagttaattgacaaa
aatagggaagacattgccaaagcagctgctgaagcggccctaatcgaaccccaacaaatt
cactccactcctgtatcttccaatgaatgcaagaagaatgaaccgtttaattcaaagcaa
agctgggttaaaagtcgctggagcatagcagttttggtgttttttgcccttgctttagct
cgtttttttggagctgattcttaa

DBGET integrated database retrieval system