KEGG   Schizosaccharomyces pombe (fission yeast): SPAC11E3.04cHelp
Entry
SPAC11E3.04c      CDS       T00076                                 

Gene name
ubc13, spu13
Definition
ubiquitin conjugating enzyme Ubc13 (EC:6.3.2.19)
Orthology
K10580  
ubiquitin-conjugating enzyme E2 N [EC:6.3.2.19]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:spo04120]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(join(5287384..5287556,5287614..5287698,5287851..5288012,5288055..5288081))
Genome map
AA seq 148 aa AA seqDB search
MALPKRIIKEIETLTRDPPPGIVAAPTEDNLRYFKITMEGPQQSAYEGGKFHLELFLPDE
YPMMPPNVRFLTKIYHPNVDKLGRICLSTLKKDWSPALQIRTVLLSIQALMGAPNPDDPL
DNDVAKIWKENEPQAIANAREWTKKYAV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggctttgcctaagcgtattattaaggaaattgaaacccttacgagagatcctccaccc
ggaattgtagcggctcccactgaagataatcttcgctattttaaaattactatggaaggg
cctcagcaatcagcttatgaaggtggaaaatttcacttagagctgtttcttcctgatgag
tatccaatgatgcctcccaatgttcgttttcttactaaaatttatcatccaaacgttgat
aaattaggtcgcatatgtttatctacgttaaaaaaggattggagtcctgctttacaaatt
cgaaccgtgctactttcgatacaggcattaatgggtgctcccaacccagatgacccttta
gacaatgatgttgcaaagatttggaaagaaaatgagccacaggcaattgcaaatgcccgt
gaatggacgaaaaagtatgcagtttga

DBGET integrated database retrieval system