KEGG   Schizosaccharomyces pombe (fission yeast): SPAC11E3.04cHelp
Entry
SPAC11E3.04c      CDS       T00076                                 

Gene name
ubc13, spu13
Definition
(RefSeq) ubiquitin conjugating enzyme Ubc13 (EC:6.3.2.19)
  KO
K10580  
ubiquitin-conjugating enzyme E2 N [EC:2.3.2.23]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC11E3.04c (ubc13)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     SPAC11E3.04c (ubc13)
Ubiquitin system [BR:spo04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   SPAC11E3.04c (ubc13)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic Type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    SPAC11E3.04c (ubc13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(join(5287384..5287556,5287614..5287698,5287851..5288012,5288055..5288081))
Genome map
AA seq 148 aa AA seqDB search
MALPKRIIKEIETLTRDPPPGIVAAPTEDNLRYFKITMEGPQQSAYEGGKFHLELFLPDE
YPMMPPNVRFLTKIYHPNVDKLGRICLSTLKKDWSPALQIRTVLLSIQALMGAPNPDDPL
DNDVAKIWKENEPQAIANAREWTKKYAV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggctttgcctaagcgtattattaaggaaattgaaacccttacgagagatcctccaccc
ggaattgtagcggctcccactgaagataatcttcgctattttaaaattactatggaaggg
cctcagcaatcagcttatgaaggtggaaaatttcacttagagctgtttcttcctgatgag
tatccaatgatgcctcccaatgttcgttttcttactaaaatttatcatccaaacgttgat
aaattaggtcgcatatgtttatctacgttaaaaaaggattggagtcctgctttacaaatt
cgaaccgtgctactttcgatacaggcattaatgggtgctcccaacccagatgacccttta
gacaatgatgttgcaaagatttggaaagaaaatgagccacaggcaattgcaaatgcccgt
gaatggacgaaaaagtatgcagtttga

DBGET integrated database retrieval system