KEGG   Schizosaccharomyces pombe (fission yeast): SPAC11G7.02Help
Entry
SPAC11G7.02       CDS       T00076                                 

Gene name
pub1
Definition
(RefSeq) HECT-type ubiquitin-protein ligase E3 Pub1 (EC:6.3.2.-)
  KO
K10591  
E3 ubiquitin-protein ligase NEDD4 [EC:2.3.2.26]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Endocytosis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC11G7.02 (pub1)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    SPAC11G7.02 (pub1)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     SPAC11G7.02 (pub1)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  HECT type E3
   SPAC11G7.02 (pub1)
Mitochondrial biogenesis [BR:spo03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Morphogenesis factors
    SPAC11G7.02 (pub1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(3963323..3963339,3963391..3963413,3963465..3963609,3963752..3965870)
Genome map
AA seq 767 aa AA seqDB search
MSNSAQSRRIRVTIVAADGLYKRDVFRFPDPFAVLTVDGEQTHTTTAIKKTLNPYWNETF
EVNVTDNSTIAIQVFDQKKFKKKGQGFLGVINLRVGDVLDLAIGGDEMLTRDLKKSNENT
VVHGKIIINLSTTAQSTLQVPSSAASGARTQRTSITNDPQSSQSSSVSRNPASSRAGSPT
RDNAPAASPASSEPRTFSSFEDQYGRLPPGWERRTDNLGRTYYVDHNTRSTTWIRPNLSS
VAGAAAAELHSSASSANVTEGVQPSSSNAARRTEASVLTSNATTAGSGELPPGWEQRYTP
EGRPYFVDHNTRTTTWVDPRRQQYIRSYGGPNNATIQQQPVSQLGPLPSGWEMRLTNTAR
VYFVDHNTKTTTWDDPRLPSSLDQNVPQYKRDFRRKLIYFLSQPALHPLPGQCHIKVRRN
HIFEDSYAEIMRQSATDLKKRLMIKFDGEDGLDYGGLSREYFFLLSHEMFNPFYCLFEYS
SVDNYTLQINPHSGINPEHLNYFKFIGRVIGLAIFHRRFVDAFFVVSFYKMILQKKVTLQ
DMESMDAEYYRSLVWILDNDITGVLDLTFSVEDNCFGEVVTIDLKPNGRNIEVTEENKRE
YVDLVTVWRIQKRIEEQFNAFHEGFSELIPQELINVFDERELELLIGGISEIDMEDWKKH
TDYRSYSENDQIIKWFWELMDEWSNEKKSRLLQFTTGTSRIPVNGFKDLQGSDGPRKFTI
EKAGEPNKLPKAHTCFNRLDLPPYTSKKDLDHKLSIAVEETIGFGQE
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaactcagctcaatctcgtcgaattcgagtaacaattgttgctgctgatggcctt
tacaaacgagatgtgtttcgttttcctgacccgtttgcggtactaacagtggatggtgag
caaacacataccacaactgctatcaaaaagacgttaaacccttattggaatgagactttt
gaagttaatgttacagataatagcaccattgcgattcaggtgttcgatcagaaaaaattt
aagaaaaaaggccaaggctttctaggagtgataaatcttcgtgttggagatgtgctcgat
ctcgccattggaggtgatgaaatgttgacccgcgatttgaaaaagtcaaatgagaataca
gtagttcatggcaagataatcataaacttatcaacgactgcgcagtcaaccttacaggtt
ccatccagtgcagcatcaggtgcacgtacccaacgtactagcattaccaatgacccgcaa
agctcacaaagtagcagtgtgtctcgtaaccctgcttcctctcgtgctggttcacctacc
cgcgacaacgcacctgctgcttcccctgctagttcagaacctcgcacatttagttcattt
gaagatcaatatgggcgccttcctcctggatgggaaagacgtaccgataatcttggccga
acttattatgtagatcataatacaagaagcacaacgtggattcgccccaacctaagttct
gttgccggagcagccgcagccgaattgcatagtagtgcatcgtctgcgaatgttaccgaa
ggtgttcaaccttcctctagcaatgcagctcgtcgtacagaagctagtgttttgacctct
aacgctactactgctggttcaggagagcttccaccgggatgggagcaaaggtatacacca
gagggtcgaccctactttgtggatcataatacgcgaactactacttgggtggatccgcgc
cgtcaacagtacattcgttcctatggcggtcctaataatgctactattcagcaacaacct
gtctctcaacttggtcctttgccaagtggttgggaaatgcgtcttaccaatactgctcgt
gtatattttgttgatcacaataccaagactaccacttgggatgatcctcgtttaccttcg
tcgttagatcaaaacgttcctcaatacaaacgtgatttccgtagaaagttgatttatttc
ctttcgcaaccagctttgcatcctttgccagggcagtgccacattaaagtgcgtagaaat
catatctttgaagattcgtatgcggaaattatgagacaatctgcaaccgatttgaaaaaa
cgtttgatgattaagtttgatggtgaagatggtttggattacggtggattatcccgtgaa
tacttctttttgttatcacatgaaatgttcaaccccttttattgtttatttgaatactct
tcggttgataattatacgcttcaaattaatcctcattctggcattaatccagagcatttg
aactatttcaagttcataggccgagtcattggtctcgcaattttccatcgtcggtttgtt
gatgcctttttcgttgtttctttttacaaaatgattttacaaaagaaggtgacgttacag
gatatggaaagtatggatgcagagtattatcgaagtttagtctggattttggacaacgat
ataaccggtgttcttgatttgacctttagtgtcgaagacaattgttttggcgaggttgtt
acgattgatttgaagccgaatggtcgaaacattgaagttacagaagagaataaacgcgaa
tatgttgatttggtgactgtatggcgcattcaaaaacgtatagaagagcagtttaatgca
tttcatgaaggttttagtgagctcataccacaggaactgattaacgtgtttgacgagaga
gaattggagttgttgattggaggcatttccgaaattgacatggaggattggaagaagcat
acggattatcgttcatacagtgaaaatgaccagattattaaatggttttgggaacttatg
gatgaatggagtaatgaaaagaaatccagacttttacaatttaccactggtactagccga
attcctgtcaacgggttcaaagatttgcaaggaagtgatggcccccgtaagtttactatt
gaaaaagctggtgaacccaataaacttcccaaggcccacacctgtttcaatcgacttgat
cttcctccttatacttcgaaaaaagatttggatcataaattgtccatagctgttgaagag
acgattggttttggtcaggagtaa

DBGET integrated database retrieval system