KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1250.03Help
Entry
SPAC1250.03       CDS       T00076                                 

Gene name
ubc14
Definition
(RefSeq) ubiquitin conjugating enzyme Ubc14 (predicted)
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(join(5098187..5098405,5098507..5098713,5098775..5098816))
Genome map
AA seq 155 aa AA seqDB search
MASASPSSSRRLTKEYSDLREHPIPDIRVNLVDDNLFHWACTALGPSDSVYAGGKFHFSL
KFPLDYPFQPPTIEFTTRIYHPNFDSEGNVCLAILKQQVFKPSIKLRSVLEQILQLLREP
NPDDPLVASIAEQYRNDRPSFDKIARDYVEQFAKS
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgcatcaccttcatcttccagaagactgacaaaagaatattctgacttgcga
gaacaccctattccagatattcgagttaacctagttgacgacaatctatttcactgggct
tgtacagctcttggtccatcggattcggtgtacgcagggggaaaatttcatttctcatta
aaatttcctttggactatccatttcagcctcctactattgagtttactaccagaatatac
catccaaattttgactctgaaggaaacgtttgtttggccattttgaaacaacaagttttc
aaacccagcatcaaactgaggagtgttttggagcaaattttgcaacttcttagggaacct
aatcctgacgatcctcttgtagcttccatcgctgaacaatatcgaaacgatcgcccttcg
tttgacaaaattgctagggattatgtcgagcaattcgccaagtcttga

DBGET integrated database retrieval system