KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1296.06Help
Entry
SPAC1296.06       CDS       T00076                                 

Gene name
tah18
Definition
NADPH-dependent diflavin oxidoreductase, involved in iron-sulfur cluster assembly Tah18 (predicted)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     SPAC1296.06 (tah18)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(719447..719581,719663..719740,719791..719888,719926..720024,720066..721410)
Genome map
AA seq 584 aa AA seqDB search
MKNSHIYILYGSETGTAEGLAESLFRSLTRMGYDVLVNSMDDFNLENLLRPLQCVFICST
TGQGEMPLNMRKFWRFLLRKKLPNTFLNDMQYAVFGCGDTSYTRFNWASKKLDSRLRQLG
AQSFSSRGEGDEQHPDGVEGVFAYWCNHLYSQLAAIKTPSRPAFGEFDLLPPSFQIIIDE
SLGCKVKGFEDNNIVRHSRGKIEATLVHNKRISNIKHWQDVRHLAFKIPNFERWKPGDVA
VLYPWNDDMSVNSFIECMGWESIKYSPLIISSNVAERKLPWFPNILNVFNLVKYVLSIHS
VPSRTFFEMASHFSNNKMHKERLQEFSSYKNIDDYYDYTTRPRRTVLETLQEFKSVQIPI
EYALDAFPVIRGRQYSIANRCDNSTGILELAVALVKYQTILKSPRQGICSRWICDLHENT
SFNIDILPGFLNLSYQSNKPLIMVGPGTGVAPLRALIQERIYNGLKENLLFFGCRNKSMD
FLFEKDWEKYTEEGTLKLFCAFSRDQEKKKYVQHSIQENGELVYNLLNEKDGMFFVSGSS
GKMPSSVKDAIAGIVSKYSGCSISDGYSFVTSLEKKNRYYQETW
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcacacatatacatattatatggttccgaaactggaaccgctgagggttta
gcggaatcactatttcgtagtcttacacgaatgggttacgatgtgttggtaaattcgatg
gatgatttcaacttagaaaatttgttgcgtccacttcaatgtgtatttatttgcagtaca
actggtcaaggggagatgccccttaatatgaggaaattttggagattcttactaagaaaa
aaactacccaacactttcttaaatgatatgcaatatgcggtgtttggttgcggtgacact
tcatatacgagattcaattgggcttccaaaaaattggatagtcggttgcgccagttgggt
gcacaatcgtttagttcgcgtggtgagggtgatgaacagcatcctgatggtgttgaaggt
gtttttgcatattggtgcaatcacttatattctcaactggctgccataaaaaccccctct
cgtccagccttcggagaattcgatttgctaccgccttcgttccaaattattatagacgaa
agtttaggttgcaaagtaaaaggatttgaagataataatattgttcgccattctcgtggg
aaaattgaagcaactcttgtacataataaacggataagtaatataaagcattggcaagat
gttcgtcatctcgcttttaaaattccaaactttgaaaggtggaagccaggagacgttgct
gttctttatccttggaatgatgatatgagcgttaactcgttcattgaatgcatgggttgg
gaatccataaaatactctcctttgattatttcttccaacgttgccgaacgcaagcttccc
tggtttccaaatattttgaacgtttttaatcttgtgaaatacgtcctttcaatccattca
gtaccatcaagaacattctttgaaatggcatctcacttctcaaataataagatgcataaa
gaacgtcttcaagaattttcttcttacaaaaacattgatgattattatgattacacaact
aggcctagaaggactgttttggaaactcttcaggaattcaaatctgtccaaatacctatc
gagtatgcattagatgcctttccagttattcgtggacgtcaatattctatagcaaataga
tgtgataattctactggaattttggaattggcggtagcgctggtgaaatatcaaactata
ttgaaaagtcctcgacaaggtatatgcagtcgttggatatgtgatttacacgaaaatacc
tcttttaatattgatattcttcccggatttctaaatctatcttaccaaagtaataagcca
ttaattatggttggcccaggaacaggagttgcacctttaagagcattaattcaagaacga
atatataatggcttaaaagaaaatcttctgttttttggatgtagaaacaaatctatggat
tttctttttgaaaaggattgggaaaaatacaccgaagaaggcacactgaaattgttttgt
gctttctcacgcgatcaagaaaaaaagaaatacgtgcaacactcaattcaagaaaatggc
gagttagtatataatttattaaatgagaaagatggcatgttctttgtaagtggatcttcg
ggcaaaatgcctagttctgtgaaagacgcgattgctggcattgtttctaaatattcgggc
tgcagtatatctgatggttatagttttgtcacttcattggaaaagaagaatagatattac
caggaaacctggtaa

DBGET integrated database retrieval system