KEGG   Schizosaccharomyces pombe (fission yeast): SPAC12B10.01cHelp
Entry
SPAC12B10.01c     CDS       T00076                                 

Definition
ubiquitin-protein ligase E3 (predicted)
Orthology
K10590  
E3 ubiquitin-protein ligase TRIP12 [EC:6.3.2.19]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:spo04120]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(4570498..4575441)
Genome map
AA seq 1647 aa AA seqDB search
MSVQAYTNTPNLPNLIHSESITNSPVFIPNLRSKSDNKHRLNTSEELPFTKKRRATKHFL
KMEVSAKISEPPSSKSVEFGRHLNMRHDFSELLEQPLTTSKTRVFKSFNEKLKGKPQLVK
SDKGVLPLNKQSDILNSYERVLSNASVDSALDKKAEVDIIPFDKSVMEPKNITFNDKSGL
TKFGNSNSYETTYSDSSNYHTSTDSSQYNDQDDHVYDDTNDGTDDDINNNEYKDDESSSG
SESYERDEDVDEEEEEDDDENNDEGDDEDENENDELRSENGSPNPSAAVINEQENMNMSG
IEEYDETNLLNELGRIRRGNQFQSLASSILSSGNLENSDDEDVSLGPQTYRFNSSFHPFR
SAFSAPGVQFGRLLEGIKDFSDPTVQMLSLQELSEAFAMSTEDMLVGLFSTDSYIAAFSE
ILSGRNYDFGEVSIQLMLSCTTCVSNMMEALPLCMAKIAYSPIVRILCERMFDMQYIDIA
EQALGVLERLSKDFGICILEHRGMLAALQYFDFFYTTVQRTAISLAANCCKFLDESNASA
AEEIIPLLSNILQSSDTIVVSKAYSCLETIIESLKTSPNIIETIISEDLITTIVNALTNS
TSQNKSMHLQVQLLHIISSLCQSSSALILPFLNHNLPDVMYEMLCGIPPSDTSHQADMIT
MQSLYYCPIELIENLLRAITSLLPKNTSNLSDEFNTKLYRLNSILLTVVMDIYFIVPLHD
IRSLAVTTALKMLCSIRENNLDGLVCSLPLSSFIASILNSRKSDNFLKRDALEMCLFLLE
ALPNVYSSLFIREGVVQEVGFLVRSTNADMKKIKLSISFSQNKSAARHEELKNLSTLKSL
AKEFLSNYKEENLENSTLVQLKQLSKHLLSETKQDESFSELAKIFQEGSNITSHELLHSG
LIHNLLLSLKKFGSSSLRTFLLAMNTCDEREVLEFGNGPLVSLIFCLQNLLSTVENFQLS
TLPPDTENAVDHVFSRQFKLRLMALPGSRIRPPFRSLVVSINGLATIRTLDNYLHSRISV
RNETGRRFSILREAGSLRESMSGSSRNSSGDYTDSMSQDAPNHTTEPSERRDSSTSSHFE
EHFVFSLMGKKVPRNKTIFRILYEYIQLSDDHTLDDFWKTPVPIFYGEPDCIHNDMKGEL
NYENETEGFSINIREILDLLSILYYGIRDVHTLFPDKHFRGNIENILTDFSNWKLSAKLN
RQLEEQQLVVHGCLPSWCISLTSAYPFLVPFETRYLLLQSTAFGLSRSVSFLLSRNPELS
KNESSSILQFVSLHRQKIRISRKKIFNYALHLLATYAASENILEIEYEDEVGSGLGPTLE
FYTSVSKEFTLNSLDIWRNDQPNSKFVYQASGLFPSPIPLLGSSPENERKISLFFALGQF
VARSIYDSRIISIQFNPLFFARNIPLTISSVAKVDKGLANSLRYLEKLIPGKNPTNAETD
IKLEDLHLDFTLPGFPSIELIPDGASTPVTTFNVSDYLNYVIDYTVGKGVQQQLEAFQNG
FSSVFPYTSLQVLTEHELVTLFGTVDEDWSYATLMKSIVADHGYTMESPTIQRLLTLMSQ
MNFQEQRDFLQFITGSRKLPIGGFAGLNPPLTVVRRLNEPPYVPDDYLPSVMTCVNYLKL
PEYSSSEVLGSRLSKAILEGQGSFHLS
NT seq 4944 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttcaagcgtatacgaatactccgaatttaccgaatttaatacatagtgaatct
ataaccaactcacctgtgtttataccaaacctacgaagtaagtccgacaacaaacataga
ttaaacacttctgaagaattgccatttacaaagaaacgcagagcaactaaacatttttta
aaaatggaggtatctgccaaaatttctgaaccaccttctagtaaaagtgtggaatttgga
aggcatttaaatatgcggcatgatttttccgaattgcttgaacaaccacttacaacgagc
aaaactagggtctttaaatcctttaatgaaaagctcaaaggtaaaccccagttagtgaaa
tccgataaaggtgtgttgcctcttaataagcaatcggatatactgaattcttatgaacgc
gttttaagcaatgcttcggttgattctgcattagacaaaaaggcggaagttgatatcatt
ccatttgataaatcagttatggaaccaaagaacataacttttaatgacaaaagtggctta
accaagtttgggaattcaaactcttatgaaactacgtattctgactccagcaactatcat
acttctactgattcgtcccaatataatgaccaagatgaccacgtctatgatgatactaat
gatggaactgatgatgatataaataataacgagtacaaagacgatgaatccagtagtggc
agtgaaagttatgaaagagatgaagatgttgatgaagaggaggaagaagacgatgatgaa
aacaatgatgagggagacgatgaagatgaaaatgaaaatgacgagttaagaagcgaaaac
ggttcacctaatccttcagccgctgttattaatgaacaagaaaacatgaacatgagtgga
atcgaagaatacgatgaaactaacttgttaaatgaactgggaagaatcagaagaggtaat
cagtttcaaagtttagcgtcttctatactttcttccggtaatttggagaactctgatgac
gaagatgtttctttaggtccacagacataccgtttcaatagttcctttcatccttttcgt
tctgcattttctgctccaggtgttcaatttggacgcttgttagaaggaataaaggatttt
agtgatcctactgttcaaatgctttctcttcaagaactttccgaagcgtttgctatgagt
actgaagatatgcttgttggattgttttcaaccgattcatacattgcggctttttccgaa
atcttatctgggcgaaattatgatttcggagaagtctctattcaacttatgctatcctgt
actacctgtgtatctaatatgatggaagctttgcctttatgtatggctaaaatagcatat
agtcctattgttcgcattctgtgtgaaagaatgtttgatatgcaatacattgatattgct
gaacaagctttaggagttttagaacggctttctaaagattttggtatttgtattttggaa
cacagaggaatgttagctgctctccaatactttgattttttttatactacagttcaacgg
acagctatttctctggctgctaattgctgtaagtttttggatgaatccaatgcttccgca
gcagaagaaattattccattgctttctaatattctacaatcttctgataccatagtcgtt
agtaaggcatattcttgcctggagacaattattgaatctttgaaaacttcaccaaacata
attgaaacgataatttccgaggatttgatcaccactattgtcaatgctttgactaattct
acctcacaaaataagtcaatgcacttacaagtgcagctattacatataatatcatctttg
tgtcagtcatcttctgctttgattttaccttttcttaaccataatttgccggatgtgatg
tacgaaatgctgtgtggaataccaccttctgatacatcccatcaggctgatatgattaca
atgcaaagtttgtattattgtccgatcgagttaatagaaaacttgttaagagctataact
tctttgcttcctaaaaacactagtaacttgtctgatgaatttaacacgaaactatatcga
ttaaacagtatactcttaactgttgtaatggacatttattttattgtgccccttcatgat
atccgatcgttagctgtgactacggcattgaaaatgttatgttcaattagggaaaataat
ttagatggcttagtttgttctcttcctttatcatcattcattgcttcaattttaaattca
cgcaaatctgacaatttcttgaagcgagatgctttagaaatgtgtctatttttgcttgaa
gcacttcctaatgtttattcttcgttatttatacgagaaggcgttgtacaggaggttgga
tttttagttcgctctaccaatgcagacatgaagaaaataaagttaagtatttccttttca
caaaacaaatctgctgctcgtcatgaggagttgaagaatttatcgacgttaaagagcctt
gccaaggagtttctctctaattataaggaagaaaatttagaaaactcaacattagttcaa
cttaaacaattgtctaaacatttattaagtgagaccaaacaagacgaatctttttcagaa
ctagccaaaatatttcaagaaggatctaatattactagtcatgaattacttcattctgga
ttaattcataatttgcttttatcactcaaaaaatttggaagttcatctcttcgaacattt
ttgttagctatgaatacatgtgatgaacgcgaagttttagaatttggtaatggtccctta
gtttcacttatcttttgtttgcaaaatctactttcaactgttgagaattttcaactttca
acgttacccccagatactgagaatgcggtagatcatgttttttcgcggcagtttaaactt
cgtttaatggctcttccgggatcaagaattcgaccacctttccgatctcttgtcgtttct
attaatgggctagctactattcgtacacttgataattatcttcacagtcgcatttctgtg
cgtaatgaaactggacgtcgtttttcaatcctccgcgaggccggttctttgagggagtca
atgagtggatcatctcgtaactcttcaggagactatactgactcaatgtctcaagatgct
cctaatcacacaacagagccatcagagcgacgtgactcctcgacatcatcacatttcgag
gaacattttgtattcagtttgatgggtaaaaaggtaccccgaaacaaaacaatattcaga
attttatatgagtatatacagttgtctgacgatcatactctcgatgatttttggaaaact
cctgtcccaatattttatggtgagcctgattgcattcacaatgatatgaaaggggagtta
aactatgagaatgaaacagagggattttctataaatattagagaaatattggatttattg
agtattttgtattatgggattagagacgttcataccctctttcctgacaaacatttccgt
ggcaacattgaaaacattcttacagattttagcaactggaagttgagtgccaaattgaat
agacaacttgaagagcaacaacttgttgttcacggttgtttaccctcctggtgtatatca
ctaacctctgcatatccattcctagtaccgtttgaaactcgatatcttttattgcaatct
actgcttttggtttatcaagatccgtttcttttcttttgtcccgaaatcctgagctatca
aaaaacgaaagttcctccatacttcaatttgtcagcttacatcgccagaaaattcgtatt
tctcggaaaaaaatatttaattacgctttgcatttgcttgcaacttatgcggcttctgaa
aatattcttgaaatagaatacgaagatgaagttggttcaggtcttgggcccactttggag
ttctatacttcagtatctaaagaatttaccttaaattctctcgatatttggcggaatgat
caacccaactctaaatttgtgtaccaagcgtctggactttttccttctcctattccatta
ttagggtccagtccagaaaatgaaagaaaaatttcgttgttctttgctcttggacagttc
gttgcacgctcgatttatgattcaaggataataagcattcagtttaatccacttttcttt
gcacgaaatatacctttaaccatttcctctgtagcgaaagttgacaagggcttagctaac
tcgttacgatatttagagaaattaataccgggtaaaaaccctacaaacgccgagacggac
attaagcttgaagaccttcatctcgattttactctaccgggatttccgtctattgaactc
atacctgatggagctagtacacctgtgacaacattcaatgtgagtgattatttaaattat
gtcattgactatactgttggaaagggtgttcaacaacaattagaagcatttcaaaatggg
ttttccagcgtttttccttatacttctttgcaagttttgacagaacatgaattggtcaca
ctattcggtactgtcgatgaggattggagttacgcgaccttgatgaaatctatagtagca
gatcacggttacaccatggaaagtcctacaatccagagattactgactttgatgagtcaa
atgaattttcaagaacaaagagactttttgcaatttattactggaagccgaaaacttcct
attggaggatttgctggcctaaatcccccgttaactgttgttaggcgcttaaatgaacct
ccttatgtacctgatgattatcttccaagcgtgatgacttgtgtgaattatttgaaacta
cctgagtattcttcaagtgaggttttaggaagtcgactttctaaggctattttagaagga
cagggcagttttcatttatcctaa

DBGET integrated database retrieval system