KEGG   Schizosaccharomyces pombe (fission yeast): SPAC139.06Help
Entry
SPAC139.06        CDS       T00076                                 

Gene name
hat1, kat1, SPAC23C4.01
Definition
histone acetyltransferase Hat1 (EC:2.3.1.48)
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SPAC139.06 (hat1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(1030230..1030287,1030338..1030441,1030503..1030721,1030811..1030926,1030998..1031361,1031418..1031693)
Genome map
AA seq 378 aa AA seqDB search
MSAVDEWVHNANECIEIVQVNEKHEKDCQYHPSNTYAIFGDAEVIYGYKDLNVTITYECP
LMVPKLEISYSERLAPDSGVEPTDIEGTLNTYLKDRSIKVEGNSFDVHSANSIHNYSFNG
KTFKILQATVLEASEIMQHLQIFSLFFIEGGSFIDLNDPRWMVYLLYETTEDDYCLRGYC
TVYKYYKWDKLIHDGIRARISQFVILPPFQHQGHGSQLYNAIVSTFLKNPKILDFTVEDA
SEAFDSLRDHCDYKRLLSMGIFSEPDFHPSLSRQWINSKIAETKLTQRQFSRCCELAFTT
KLKKLSLLERKSVRLGIKERIFRQNLDVLLQLDKSERIEKIHNAYENQFDEYKQIVKKLP
KLKEDSPRKRQKLAQSSS
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgttgatgaatgggtacataatgccaatgaatgcatagaaattgtacaagta
aacgaaaagcatgaaaaagattgtcaataccatcctagcaatacatatgcaatatttgga
gatgctgaggttatttatggatataaagatctaaatgtcactataacctatgaatgccca
ttgatggtcccaaaactggaaatctcatattcagagcgcctagcaccagattcaggagtg
gaaccaactgatattgaaggaacattaaacacttatctaaaagatcgttccattaaggtt
gaaggaaactcatttgacgttcattcggcaaatagtattcataactattcctttaatgga
aaaacattcaagattttacaagcaacggttcttgaagctagtgagattatgcagcatttg
caaatattttccttattttttattgaagggggctcttttattgaccttaatgatccaaga
tggatggtatatttactttacgagactactgaagatgattattgcttacgtggttattgt
actgtatacaaatattataaatgggacaaattaattcacgatggtattcgagctcgtatc
tcacaattcgtgattttacccccttttcaacatcaaggacacggttcgcaattgtacaat
gctattgttagtacctttttgaaaaatcctaaaattttagacttcacagttgaggatgca
tcggaagcgtttgatagccttagagaccattgcgactataaaagattattatcaatggga
atattttcagaacctgactttcatccctctctttctaggcagtggataaactcgaaaata
gctgaaacaaagttaacccagcgtcaattctcacgctgttgtgaattagcatttacaacg
aaactaaaaaagctttcattattggagcggaaatctgttagactaggaataaaggaaagg
atttttcgtcaaaatcttgatgtgttgctacagttggataagtccgaacgtattgaaaaa
attcataacgcctatgaaaatcagtttgatgagtataaacagattgtcaaaaagctaccc
aagcttaaggaagattcgcctcgaaaacgccaaaaacttgctcaatcttcttcctaa

DBGET integrated database retrieval system