KEGG   Schizosaccharomyces pombe (fission yeast): SPAC13A11.04cHelp
Entry
SPAC13A11.04c     CDS       T00076                                 

Gene name
ubp8
Definition
SAGA complex ubiquitin C-terminal hydrolase Ubp8
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SPAC13A11.04c (ubp8)
Peptidases [BR:spo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SPAC13A11.04c (ubp8)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     SPAC13A11.04c (ubp8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(join(579720..579789,579835..579899,579953..580250,580296..580983,581084..581216,581295..581390))
Genome map
AA seq 449 aa AA seqDB search
MPGDVEGCQHLKLKPADVENYQKICTQIFSCHFVPRRCSTCKRINKRSIRCLSCHSVGCL
WGHHGEEHAMEHTHMIGVDVKNGHTYCFGCQDYVYQTELETLRFKIKNIKAWQSDHKRLP
EKYNQMVCLEAYRKYPPVCATAGLRGIQNLGATCFMSVILQSILHNPLVRNLFFSGFHTS
TDCKRPTCMTCAIDDMFSSIYNSKNKSTFYGPTAVLNLMWKLSKSLCGYSQQDGHEFFVY
LLDQMHTESGGGTSMPCTCPIHRIFSGSLKNVVTCLDCKKERVAVDPLMDISLDINEPTL
QGCLERFVSKEKVQYSCHSCGSKNAIKQLVFDKLPPTICMQLKRFEQNNFAMSTKIDKQV
SYPAFLRMRYNFNQDDVDYQLYSVVCHKGTLDTGHYIAYTYYQNQWFLLDDTTIVEVKES
EVLNSQAYLLFYHERQILYSDEMTVKTEN
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcctggggatgtagaaggttgccagcatcttaaacttaaaccggcggatgttgaaaac
tatcaaaagatctgtacccagatattcagttgtcattttgtcccacgtcgctgcagtact
tgcaaacgcatcaacaagcggagtattcgatgcttgagttgtcattctgtgggatgtctt
tggggacatcatggtgaagaacacgcaatggagcacactcatatgatcggcgtggatgta
aaaaatggccatacctactgctttggctgtcaagactacgtttatcagaccgagttggaa
acccttcgttttaagatcaagaatatcaaggcatggcaaagtgatcacaagagacttccc
gagaagtacaatcaaatggtttgcttagaagcctatcgaaaataccctccagtttgcgca
acagcaggcttgagggggatccagaacttgggtgctacttgtttcatgagcgtcatttta
caaagtattttgcataatccattggttcgaaacttgtttttcagtgggtttcatacttct
actgattgtaagcgacctacttgcatgacttgtgccattgacgatatgttttcatctatt
tataattctaaaaacaaatctactttttacggtcccactgctgtcttaaatcttatgtgg
aaactcagcaaatctttatgtggttactcccagcaagatggccacgaattttttgtatac
ttgctggaccaaatgcatacggaaagcggaggaggaacatcaatgccgtgcacttgtcct
attcatcgtatttttagtggatctctgaaaaacgttgttacatgcctagattgcaagaag
gagcgggtggctgtggatcctttgatggacattagtttagacatcaatgagccaacactt
caaggatgtttggaaaggtttgtttccaaagagaaagttcaatatagctgtcatagttgc
gggtcaaaaaatgctattaaacaattggtctttgacaaactacctccaactatttgcatg
caattgaaacgatttgaacaaaataactttgccatgtcaactaaaatagataagcaagta
tcttatccagcatttttaagaatgcgctacaactttaatcaagatgatgtggattatcaa
ttatactcagttgtgtgtcataaaggaactctcgacacagggcactatattgcctataca
tactaccaaaatcaatggtttttgctggatgacaccacaattgtggaagtaaaggaatcg
gaggtcttaaattctcaagcttacctattattttaccatgagcgtcaaatcctatacagt
gatgaaatgactgttaaaacggaaaattga

DBGET integrated database retrieval system