KEGG   Schizosaccharomyces pombe (fission yeast): SPAC13F5.05Help
Entry
SPAC13F5.05       CDS       T00076                                 

Definition
thioredoxin family protein (predicted) (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPAC13F5.05
Enzymes [BR:spo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SPAC13F5.05
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:2180072..2181163
Genome map
AA seq 363 aa AA seqDB search
MLFRIPTLFTLFLACFSLVSGVFGYSPMFGSNTIELNSKNFRKFVKAKGPSLVVFYAPWC
GYCKKLVPTYQKLASNLHSLLPVTAVDCDADQNRAVCSQYQVQGFPTIKLVYPSSKGSSL
SSTDYNGDRSYKSLQKFVSDSIPSKVKILTSEAKTQKFIQDAQNSSKVILISQKMKPTLL
YKSLSNEFSSLPFSFMPAKANVNDLFNISAYVDTSDLPILFIKHPNNGTSFFSNSLNRDS
IVEFLQSSIKDNNFSEYLATFCSKKSCIITIQDKDSDSGIDESIRKKYPKLHFVRLGRNT
TVAERLEDTLDLGYSDTFLLSLKKSHYNAKPYGKPLRRWLEDIQVQQAGPSVSLPNDLLS
KIK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgctcttccgtattccaactttatttacgctctttttggcttgcttcagccttgtatcc
ggcgtctttggctactcaccaatgtttggatccaacacgattgagttaaattccaaaaat
tttcgtaaatttgtaaaagcaaagggcccatctttagttgtcttttatgctccgtggtgt
ggttattgcaaaaagcttgtacctacttaccaaaaattagccagcaatctacattcactc
ttgccggttactgctgtcgattgtgatgctgatcagaatagggccgtttgctctcaatac
caggtacagggctttcccactataaagttggtttatccatcttccaaaggatcttctctt
tcctctactgattacaacggtgatcgaagttacaagtctctccaaaaattcgtctctgat
tctattcccagtaaagtcaaaattttgacttctgaggcaaaaactcaaaaattcatccaa
gatgctcaaaactcctctaaggtaattctcatttctcaaaaaatgaagccgactttgctg
tacaaatctctttcaaatgagttctcgagcttacctttttcatttatgcctgcaaaagct
aatgtgaatgatcttttcaatatttctgcgtatgttgacacctccgatttacccatatta
ttcataaaacaccccaacaatggaacatcttttttttcaaattccttaaatcgggattct
attgttgaatttttacaatcttcaattaaagataataatttttcagaatacttagcaact
ttttgctcaaaaaaatcctgcattattacaattcaggataaggactcggattctggaata
gacgaatctattaggaaaaagtacccaaaacttcactttgtacgtcttggtcgaaataca
acagtagccgaaagacttgaagatacattggaccttggttatagtgacacttttcttctc
agtcttaagaaatctcattataatgctaagccctatggaaaacctttacgccgttggttg
gaagatatccaagtacaacaagcaggaccttcagtgtctttgccaaatgacctcttatca
aagattaaataa

DBGET integrated database retrieval system